SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|164607156|ref|NP_113615.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|164607156|ref|NP_113615.2|
Domain Number 1 Region: 36-183
Classification Level Classification E-value
Superfamily L domain-like 2.01e-34
Family Internalin LRR domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|164607156|ref|NP_113615.2|
Sequence length 190
Comment dynein light chain 1, axonemal isoform 1 [Homo sapiens]
Sequence
MAKATTIKEALARWEEKTGQRPSEAKEIKLYAQIPPIEKMDASLSMLANCEKLSLSTNCI
EKIANLNGLKNLRILSLGRNNIKNLNGLEAVGDTLEELWISYNFIEKLKGIHIMKKLKIL
YMSNNLVKDWAEFVKLAELPCLEDLVFVGNPLEEKHSAENNWIEEATKRVPKLKKLDGTP
VIKGDEEEDN
Download sequence
Identical sequences Q4LDG9
ENSP00000452037 gi|164607156|ref|NP_113615.2| ENSP00000452037 ENSP00000310360 NP_113615.2.87134 NP_113615.2.92137 9606.ENSP00000310360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]