SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|164663824|ref|NP_976032.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|164663824|ref|NP_976032.2|
Domain Number 1 Region: 119-202
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000025
Family I set domains 0.025
Further Details:      
 
Domain Number 2 Region: 25-111
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000116
Family I set domains 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|164663824|ref|NP_976032.2|
Sequence length 213
Comment pregnancy-specific beta-1-glycoprotein 11 isoform 2 [Homo sapiens]
Sequence
MGPLSAPPCTEHIKWKGLLLTVETPKPSISSSNLNPREAMETVILTCNPETPDASYLWWM
NGQSLPMTHRMQLSETNRTLFLFGVTKYTAGPYECEIWNSGSASRSDPVTLNLLHGPDLP
RIFPSVTSYYSGENLDLSCFANSNPPAQYSWTINGKFQLSGQKLFIPQITPKHNGLYACS
ARNSATGEESSTSLTIRVIAPPGLGTFAFNNPT
Download sequence
Identical sequences gi|164663824|ref|NP_976032.2| gi|164663826|ref|NP_001106881.1| ENSP00000304913 ENSP00000385427 ENSP00000304913 ENSP00000385427 NP_001106881.1.87134 NP_001106881.1.92137 NP_976032.2.87134 NP_976032.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]