SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|165932385|ref|NP_001107039.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|165932385|ref|NP_001107039.1|
Domain Number 1 Region: 157-283
Classification Level Classification E-value
Superfamily RNI-like 0.000000000000647
Family 28-residue LRR 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|165932385|ref|NP_001107039.1|
Sequence length 344
Comment leucine-rich repeat-containing protein C17orf76 isoform 1 [Homo sapiens]
Sequence
MGTRQTKGSLAERASPGAAPGPRRERPDFWASLLLRAGDKAGRAGAGMPPYHRRVGMVQE
LLRMVRQGRREEAGTLLQHLRQDLGMESTSLDDVLYRYASFRNLVDPITHDLIISLARYI
HCPKPEGDALGAMEKLCRQLTYHLSPHSQWRRHRGLVKRKPQACLKAVLAGSPPDNTVDL
SGIPLTSRDLERVTSYLQRCGEQVDSVELGFTGLTDDMVLQLLPALSTLPRLTTLALNGN
RLTRAVLRDLTDILKDPSKFPNVTWIDLGNNVDIFSLPQPFLLSLRKRSPKQGHLPTILE
LGEGPGSGEEVREGTVGQEDPGGGPVAPAEDHHEGKETVAAAQT
Download sequence
Identical sequences Q8NAA5
ENSP00000419502 ENSGGOP00000022198 gi|165932385|ref|NP_001107039.1| ENSP00000419502 ENSP00000419502 9606.ENSP00000419502 ENSGGOP00000004977 NP_001107039.1.87134 NP_001107039.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]