SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166235888|ref|NP_036401.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166235888|ref|NP_036401.2|
Domain Number 1 Region: 47-368
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.58e-121
Family Bee venom hyaluronidase 0.0000183
Further Details:      
 
Weak hits

Sequence:  gi|166235888|ref|NP_036401.2|
Domain Number - Region: 429-448
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0136
Family EGF-type module 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|166235888|ref|NP_036401.2|
Sequence length 481
Comment hyaluronidase-4 [Homo sapiens]
Sequence
MKVLSEGQLKLCVVQPVHLTSWLLIFFILKSISCLKPARLPIYQRKPFIAAWNAPTDQCL
IKYNLRLNLKMFPVIGSPLAKARGQNVTIFYVNRLGYYPWYTSQGVPINGGLPQNISLQV
HLEKADQDINYYIPAEDFSGLAVIDWEYWRPQWARNWNSKDVYRQKSRKLISDMGKNVSA
TDIEYLAKVTFEESAKAFMKETIKLGIKSRPKGLWGYYLYPDCHNYNVYAPNYSGSCPED
EVLRNNELSWLWNSSAALYPSIGVWKSLGDSENILRFSKFRVHESMRISTMTSHDYALPV
FVYTRLGYRDEPLFFLSKQDLVSTIGESAALGAAGIVIWGDMNLTASKANCTKVKQFVSS
DLGSYIANVTRAAEVCSLHLCRNNGRCIRKMWNAPSYLHLNPASYHIEASEDGEFTVKGK
ASDTDLAVMADTFSCHCYQGYEGADCREIKTADGCSGVSPSPGSLMTLCLLLLASYRSIQ
L
Download sequence
Identical sequences Q2M3T9
NP_036401.2.87134 NP_036401.2.92137 XP_011514292.1.92137 XP_016867400.1.92137 ENSP00000223026 ENSP00000417186 gi|166235888|ref|NP_036401.2| 9606.ENSP00000223026 ENSP00000223026 ENSP00000417186 ENSP00000417872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]