SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|167466164|ref|NP_000844.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|167466164|ref|NP_000844.2|
Domain Number 1 Region: 83-223
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.67e-30
Family Glutathione S-transferase (GST), C-terminal domain 0.0000288
Further Details:      
 
Domain Number 2 Region: 3-86
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.38e-24
Family Glutathione S-transferase (GST), N-terminal domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|167466164|ref|NP_000844.2|
Sequence length 240
Comment glutathione S-transferase theta-1 [Homo sapiens]
Sequence
MGLELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDG
DFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMF
PVFLGEPVSPQTLAATLAELDVTLQLLEDKFLQNKAFLTGPHISLADLVAITELMHPVGA
GCQVFEGRPKLATWRQRVEAAVGEDLFQEAHEVILKAKDFPPADPTIKQKLMPWVLAMIR
Download sequence
Identical sequences H2QLD4 P30711
ENSP00000248935 ENSP00000248935 ENSP00000481741 ENSPTRP00000024393 ENSPTRP00000024393 gi|167466164|ref|NP_000844.2| NP_000844.2.92137 XP_525647.2.37143 9598.ENSPTRP00000024393 9606.ENSP00000248935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]