SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|167466264|ref|NP_001006940.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|167466264|ref|NP_001006940.3|
Domain Number 1 Region: 30-198
Classification Level Classification E-value
Superfamily L domain-like 1.36e-31
Family Leucine rich effector protein YopM 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|167466264|ref|NP_001006940.3|
Sequence length 261
Comment leucine-rich repeat-containing protein 18 [Homo sapiens]
Sequence
MVKGEKGPKGKKITLKVARNCIKITFDGKKRLDLSKMGITTFPKCILRLSDMDELDLSRN
LIRKIPDSISKFQNLRWLDLHSNYIDKLPESIGQMTSLLYLNVSNNRLTSNGLPVELKQL
KNIRAVNLGLNHLDSVPTTLGALKELHEVGLHDNLLNNIPVSISKLPKLKKLNIKRNPFP
KPGESEIFIDSIRRLENLYVVEEKDLCAACLRKCQNARDNLNRIKNMATTTPRKTIFPNL
ISPNSMAKDSWEDWRIRLTSS
Download sequence
Identical sequences Q8N456
ENSP00000298124 ENSP00000298124 ENSP00000363275 NP_001006940.3.87134 NP_001006940.3.92137 XP_006717930.1.92137 XP_011538124.1.92137 XP_011538125.1.92137 XP_011538128.1.92137 XP_011538130.1.92137 XP_011538131.1.92137 XP_016871765.1.92137 XP_016871766.1.92137 ENSP00000363275 gi|167466264|ref|NP_001006940.3| 9606.ENSP00000298124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]