SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16753212|ref|NP_003921.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16753212|ref|NP_003921.2|
Domain Number 1 Region: 14-219
Classification Level Classification E-value
Superfamily PH domain-like 9.59e-54
Family Pleckstrin-homology domain (PH domain) 0.0000000047
Further Details:      
 
Domain Number 2 Region: 283-358
Classification Level Classification E-value
Superfamily SH3-domain 9.32e-16
Family SH3-domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16753212|ref|NP_003921.2|
Sequence length 359
Comment src kinase-associated phosphoprotein 2 [Homo sapiens]
Sequence
MPNPSSTSSPYPLPEEIRNLLADVETFVADILKGENLSKKAKEKRESLIKKIKDVKSIYL
QEFQDKGDAEDGEEYDDPFAGPPDTISLASERYDKDDEAPSDGAQFPPIAAQDLPFVLKA
GYLEKRRKDHSFLGFEWQKRWCALSKTVFYYYGSDKDKQQKGEFAIDGYSVRMNNTLRKD
GKKDCCFEISAPDKRIYQFTAASPKDAEEWVQQLKFVLQDMESDIIPEDYDERGELYDDV
DHPLPISNPLTSSQPIDDEIYEELPEEEEDSAPVKVEEQRKMSQDSVHHTSGDKSTDYAN
FYQGLWDCTGAFSDELSFKRGDVIYILSKEYNRYGWWVGEMKGAIGLVPKAYIMEMYDI
Download sequence
Identical sequences O75563
GO.34702 hsi002005696.1 hsi002005696.2 ENSP00000005587 ENSP00000005587 NP_003921.2.87134 NP_003921.2.92137 XP_016868260.1.92137 ENSP00000005587 gi|16753212|ref|NP_003921.2| 9606.ENSP00000005587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]