SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|169234649|ref|NP_940903.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|169234649|ref|NP_940903.2|
Domain Number 1 Region: 194-314
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.32e-34
Family Calponin-homology domain, CH-domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|169234649|ref|NP_940903.2|
Sequence length 317
Comment smoothelin-like protein 2 isoform 2 [Homo sapiens]
Sequence
MRKTSNSCIMENGHQPGAGPGDGPPEIAQNFSAPDPPRPRPVSLSLRLPHQPVTAITRVS
DRFSGETSAAALSPMSAATLGGLNPSPSEVITPWTPSPSEKNSSFTWSVPSSGYGAVTAS
KHSNSPPLVTPPQSPVSPQPPAITQVHRQGERRRELVRSQTLPRTSEAQARKALFEKWEQ
ETAAGKGKGEARARLKRSQSFGVASASSIKQILLEWCRSKTLGYQHVDLQNFSSSWSDGM
AFCALVHSFFPDAFDYNSLSPTQRQKNFELAFTMAENLANCERLIEVEDMMVMGRKPDPM
CVFTYVQSLYNHLRRFE
Download sequence
Identical sequences ENSP00000345143 ENSP00000345143 NP_940903.2.87134 NP_940903.2.92137 XP_006721578.1.92137 gi|169234649|ref|NP_940903.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]