SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16930817|ref|NP_473454.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16930817|ref|NP_473454.1|
Domain Number 1 Region: 1-185
Classification Level Classification E-value
Superfamily EF-hand 1.38e-30
Family Calmodulin-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16930817|ref|NP_473454.1|
Sequence length 187
Comment calcium and integrin-binding family member 3 [Homo sapiens]
Sequence
MGNKQTVFTHEQLEAYQDCTFFTRKEIMRLFYRYQDLAPQLVPLDYTTCPDVKVPYELIG
SMPELKDNPFRQRIAQVFSEDGDGHMTLDNFLDMFSVMSEMAPRDLKAYYAFKIYDFNND
DYICAWDLEQTVTKLTRGGLSAEEVSLVCEKVLDEADGDHDGRLSLEDFQNMILRAPDFL
STFHIRI
Download sequence
Identical sequences Q96Q77
NP_473454.1.87134 NP_473454.1.92137 9606.ENSP00000269878 gi|16930817|ref|NP_473454.1| ENSP00000269878 ENSP00000369188 ENSP00000269878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]