SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|169790811|ref|NP_036567.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|169790811|ref|NP_036567.2|
Domain Number 1 Region: 123-306
Classification Level Classification E-value
Superfamily PH domain-like 1.03e-55
Family Phosphotyrosine-binding domain (PTB) 0.0000002
Further Details:      
 
Domain Number 2 Region: 463-570
Classification Level Classification E-value
Superfamily SH2 domain 7.14e-28
Family SH2 domain 0.0000195
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|169790811|ref|NP_036567.2|
Sequence length 582
Comment SHC-transforming protein 2 [Homo sapiens]
Sequence
MTQGPGGRAPPAPPAPPEPEAPTTFCALLPRMPQWKFAAPGGFLGRGPAAARAAGASGGA
DPQPEPAGPGGVPALAAAVLGACEPRCAAPCPLPALSRCRGAGSRGSRGGRGAAGSGDAA
AAAEWIRKGSFIHKPAHGWLHPDARVLGPGVSYVVRYMGCIEVLRSMRSLDFNTRTQVTR
EAINRLHEAVPGVRGSWKKKAPNKALASVLGKSNLRFAGMSISIHISTDGLSLSVPATRQ
VIANHHMPSISFASGGDTDMTDYVAYVAKDPINQRACHILECCEGLAQSIISTVGQAFEL
RFKQYLHSPPKVALPPERLAGPEESAWGDEEDSLEHNYYNSIPGKEPPLGGLVDSRLALT
QPCALTALDQGPSPSLRDACSLPWDVGSTGTAPPGDGYVQADARGPPDHEEHLYVNTQGL
DAPEPEDSPKKDLFDMRPFEDALKLHECSVAAGVTAAPLPLEDQWPSPPTRRAPVAPTEE
QLRQEPWYHGRMSRRAAERMLRADGDFLVRDSVTNPGQYVLTGMHAGQPKHLLLVDPEGV
VRTKDVLFESISHLIDHHLQNGQPIVAAESELHLRGVVSREP
Download sequence
Identical sequences P98077
gi|169790811|ref|NP_036567.2| ENSP00000264554 ENSP00000264554 NP_036567.2.87134 NP_036567.2.92137 9606.ENSP00000264554 ENSP00000264554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]