SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|170016061|ref|NP_057726.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170016061|ref|NP_057726.3|
Domain Number 1 Region: 4-245
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.53e-71
Family Calponin-homology domain, CH-domain 0.0000184
Further Details:      
 
Domain Number 2 Region: 1228-1382
Classification Level Classification E-value
Superfamily Spectrin repeat 3.47e-29
Family Spectrin repeat 0.00099
Further Details:      
 
Domain Number 3 Region: 264-385
Classification Level Classification E-value
Superfamily Spectrin repeat 3.53e-28
Family Spectrin repeat 0.00036
Further Details:      
 
Domain Number 4 Region: 1539-1674
Classification Level Classification E-value
Superfamily Spectrin repeat 2.72e-26
Family Spectrin repeat 0.00099
Further Details:      
 
Domain Number 5 Region: 2280-2432
Classification Level Classification E-value
Superfamily Spectrin repeat 7.86e-26
Family Spectrin repeat 0.0013
Further Details:      
 
Domain Number 6 Region: 2809-2957
Classification Level Classification E-value
Superfamily Spectrin repeat 3.93e-25
Family Spectrin repeat 0.00034
Further Details:      
 
Domain Number 7 Region: 2490-2645
Classification Level Classification E-value
Superfamily Spectrin repeat 1.23e-24
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 8 Region: 2917-3068
Classification Level Classification E-value
Superfamily Spectrin repeat 1.8e-23
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 9 Region: 2703-2855
Classification Level Classification E-value
Superfamily Spectrin repeat 1.92e-23
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 10 Region: 2082-2218
Classification Level Classification E-value
Superfamily Spectrin repeat 2.64e-23
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 11 Region: 1664-1798
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-21
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 12 Region: 3492-3604
Classification Level Classification E-value
Superfamily PH domain-like 3.64e-20
Family Pleckstrin-homology domain (PH domain) 0.0046
Further Details:      
 
Domain Number 13 Region: 1442-1576
Classification Level Classification E-value
Superfamily Spectrin repeat 3.88e-20
Family Spectrin repeat 0.0008
Further Details:      
 
Domain Number 14 Region: 3254-3380
Classification Level Classification E-value
Superfamily Spectrin repeat 3.48e-19
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 15 Region: 595-709
Classification Level Classification E-value
Superfamily Spectrin repeat 1.56e-18
Family Spectrin repeat 0.00092
Further Details:      
 
Domain Number 16 Region: 1017-1171
Classification Level Classification E-value
Superfamily Spectrin repeat 2.06e-18
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 17 Region: 1856-2011
Classification Level Classification E-value
Superfamily Spectrin repeat 3.82e-17
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 18 Region: 3127-3249
Classification Level Classification E-value
Superfamily Spectrin repeat 1.1e-16
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 19 Region: 827-952
Classification Level Classification E-value
Superfamily Spectrin repeat 5.92e-16
Family Spectrin repeat 0.0065
Further Details:      
 
Domain Number 20 Region: 713-775,819-860
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000136
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 21 Region: 357-493
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000196
Family Spectrin repeat 0.0019
Further Details:      
 
Domain Number 22 Region: 503-602
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000654
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 23 Region: 2017-2112
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000892
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 24 Region: 3387-3447
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000561
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 25 Region: 1807-1869
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000935
Family Spectrin repeat 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|170016061|ref|NP_057726.3|
Sequence length 3639
Comment spectrin beta chain, brain 4 [Homo sapiens]
Sequence
MDSQYETGHIRKLQARHMQMQEKTFTKWINNVFQCGQAGIKIRNLYTELADGIHLLRLLE
LISGEALPPPSRGRLRVHFLENSSRALAFLRAKVPVPLIGPENIVDGDQTLILGLIWVII
LRFQISHISLDKEEFGASAALLSTKEALLVWCQRKTASYTNVNITDFSRSWSDGLGFNAL
IHAHRPDLLDYGSLRPDRPLHNLAFAFLVAEQELGIAQLLDPEDVAAAQPDERSIMTYVS
LYYHYCSRLHQGQTVQRRLTKILLQLQETELLQTQYEQLVADLLRWIAEKQMQLEARDFP
DSLPAMRQLLAAFTIFRTQEKPPRLQQRGAAEALLFRLQTALQAQNRRPFLPHEGLGLAE
LSQCWAGLEWAEAARSQALQQRLLQLQRLETLARRFQHKAALRESFLKDAEQVLDQARAP
PASLATVEAAVQRLGMLEAGILPQEGRFQALAEIADILRQEQYHSWADVARRQEEVTVRW
QRLLQHLQGQRKQVADMQAVLSLLQEVEAASHQLEELQEPARSTACGQQLAEVVELLQRH
DLLEAQVSAHGAHVSHLAQQTAELDSSLGTSVEVLQAKARTLAQLQQSLVALVRARRALL
EQTLQRAEFLRNCEEEEAWLKECGQRVGNAALGRDLSQIAGALQKHKALEAEVHRHQAVC
VDLVRRGRDLSARRPPTQPDPGERAEAVQGGWQLLQTRVVGRGARLQTALLVLQYFADAA
EAASWLRERRSSLERASCGQDQAAAETLLRRHVRLERVLRAFAAELRRLEEQGRAASARA
SLFTVNSALSPPGESLRNPGPWSEASCHPGPGDAWKMALPAEPDPDFDPNTILQTQDHLS
QDYESLRALAQLRRARLEEAMALFGFCSSCGELQLWLEKQTVLLQRVQPQADTLEVMQLK
YENFLTALAVGKGLWAEVSSSAEQLRQRYPGNSTQIQRQQEELSQRWGQLEALKREKAVQ
LAHSVEVCSFLQECGPTQVQLRDVLLQLEALQPGSSEDTCHALQLAQKKTLVLERRVHFL
QSVVVKVEEPGYAESQPLQGQVETLQGLLKQVQEQVAQRARRQAETQARQSFLQESQQLL
LWAESVQAQLRSKEVSVDVASAQRLLREHQDLLEEIHLWQERLQQLDAQSQPMAALDCPD
SQEVPNTLRVLGQQGQELKVLWEQRQQWLQEGLELQKFGREVDGFTATCANHQAWLHLDN
LGEDVREALSLLQQHREFGRLLSTLGPRAEALRAHGEKLVQSQHPAAHTVREQLQSIQAQ
WTRLQGRSEQRRRQLLASLQLQEWKQDVAELMQWMEEKGLMAAHEPSGARRNILQTLKRH
EAAESELLATRRHVEALQQVGRELLSRRPCGQEDIQTRLQGLRSKWEALNRKMTERGDEL
QQAGQQEQLLRQLQDAKEQLEQLEGALQSSETGQDLRSSQRLQKRHQQLESESRTLAAKM
AALASMAHGMAASPAILEETQKHLRRLELLQGHLAIRGLQLQASVELHQFCHLSNMELSW
VAEHMPHGSPTSYTECLNGAQSLHRKHKELQVEVKAHQGQVQRVLSSGRSLAASGHPQAQ
HIVEQCQELEGHWAELERACEARAQCLQQAVTFQQYFLDVSELEGWVEEKRPLVSSRDYG
RDEAATLRLINKHQALQEELAIYWSSMEELDQTAQTLTGPEVPEQQRVVQERLREQLRAL
QELAATRDRELEGTLRLHEFLREAEDLQGWLASQKQAAKGGESLGEDPEHALHLCTKFAK
FQHQVEMGSQRVAACRLLAESLLERGHSAGPMVRQRQQDLQTAWSELWELTQARGHALRD
TETTLRVHRDLLEVLTQVQEKATSLPNNVARDLCGLEAQLRSHQGLERELVGTERQLQEL
LETAGRVQKLCPGPQAHAVQQRQQAVTQAWAVLQRRMEQRRAQLERARLLARFRTAVRDY
ASWAARVRQDLQVEESSQEPSSGPLKLSAHQWLRAELEAREKLWQQATQLGQQALLAAGT
PTKEVQEELRALQDQRDQVYQTWARKQERLQAEQQEQLFLRECGRLEEILAAQEVSLKTS
ALGSSVEEVEQLIRKHEVFLKVLTAQDKKEAALRERLKTLRRPRVRDRLPILLQRRMRVK
ELAESRGHALHASLLMASFTQAATQAEDWIQAWAQQLKEPVPPGDLRDKLKPLLKHQAFE
AEVQAHEEVMTSVAKKGEALLAQSHPRAGEVSQRLQGLRKHWEDLRQAMALRGQELEDRR
NFLEFLQRVDLAEAWIQEKEVKMNVGDLGQDLEHCLQLRRRLREFRGNSAGDTVGDACIR
SISDLSLQLKNRDPEEVKIICQRRSQLNNRWASFHGNLLRYQQQLEGALEIHVLSRELDN
VTKRIQEKEALIQALDCGKDLESVQRLLRKHEELEREVHPIQAQVESLEREVGRLCQRSP
EAAHGLRHRQQEVAESWWQLRSRAQKRREALDALHQAQKLQAMLQELLVSAQRLRAQMDT
SPAPRSPVEARRMLEEHQECKAELDSWTDSISLARSTGQQLLTAGHPFSSDIRQVLAGLE
QELSSLEGAWQEHQLQLQQALELQLFLSSVEKMERWLCSKEDSLASEGLWDPLAPMEPLL
WKHKMLEWDLEVQAGKISALEATARGLHQGGHPEAQSALGRCQAMLLRKEALFRQAGTRR
HRLEELRQLQAFLQDSQEVAAWLREKNLVALEEGLLDTAMLPAQLQKQQNFQAELDASMH
QQQELQREGQRLLQGGHPASEAIQERLEELGALWGELQDNSQKKVAKLQKACEALRLRRS
MEELENWLEPIEVELRAPTVGQALPGVGELLGTQRELEAAVDKKARQAEALLGQAQAFVR
EGHCLAQDVEEQARRLLQRFKSLREPLQERRTALEARSLLLKFFRDADEEMAWVQEKLPL
AAAQDYGQSLSAVRHLQEQHQNLESEMSSHEALTRVVLGTGYKLVQAGHFAAHEVAARVQ
QLEKAMAHLRAEAARRRLLLQQAQEAQQFLTELLEAGSWLAERGHVLDSEDMGHSAEATQ
ALLRRLEATKRDLEAFSPRIERLQQTAALLESRKNPESPKVLAQLQAVREAHAELLRRAE
ARGHGLQEQLQLHQLERETLLLDAWLTTKAATAESQDYGQDLEGVKVLEEKFDAFRKEVQ
SLGQAKVYALRKLAGTLERGAPRRYPHIQAQRSRIEAAWERLDQAIKARTENLAAAHEVH
SFQQAAAELQGRMQEKTALMKGEDGGHSLSSVRTLQQQHRRLERELEAMEKEVARLQTEA
CRLGQLHPAAPGGLAKVQEAWATLQAKAQERGQWLAQAAQGHAFLGRCQELLAWAQERQE
LASSEELAEDVAGAEQLLGQHEELGQEIRECRLQAQDLRQEGQQLVDNSHFMSAEVTECL
QELEGRLQELEEAWALRWQRCAESWGLQKLRQRLEQAEAWLACWEGLLLKPDYGHSVSDV
ELLLHRHQDLEKLLAAQEEKFAQMQKTEMEQELLLQPQELKPGRAGSSLTSFQWRPSGHQ
GLGAQLAETRDPQDAKGTPTMEGSLEFKQHLLPGGRQPSSSSWDSCRGNLQGSSLSLFLD
ERMAAEKVASIALLDLTGARCERLRGRHGRKHTFSLRLTSGAEILFAAPSEEQAESWWRA
LGSTAAQSLSPKLKAKPVSSLNECTTKDARPGCLLRSDP
Download sequence
Identical sequences gi|170016061|ref|NP_057726.3|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]