SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|17933772|ref|NP_525127.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17933772|ref|NP_525127.1|
Domain Number 1 Region: 5-97
Classification Level Classification E-value
Superfamily EF-hand 3.46e-18
Family S100 proteins 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|17933772|ref|NP_525127.1|
Sequence length 103
Comment protein S100-A16 [Homo sapiens]
Sequence
MSDCYTELEKAVIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAAD
KLIQNLDANHDGRISFDEYWTLIGGITGPIAKLIHEQEQQSSS
Download sequence
Identical sequences Q96FQ6
ENSP00000357692 ENSP00000357693 ENSP00000357694 ENSP00000357695 ENSP00000357692 ENSP00000357693 ENSP00000357694 ENSP00000357695 ENSP00000357692 gi|17933772|ref|NP_525127.1| NP_001303936.1.87134 NP_001303936.1.92137 NP_001303937.1.87134 NP_001303937.1.92137 NP_525127.1.87134 NP_525127.1.92137 9606.ENSP00000357692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]