SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|17986258|ref|NP_066299.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17986258|ref|NP_066299.2|
Domain Number 1 Region: 4-149
Classification Level Classification E-value
Superfamily EF-hand 1.21e-37
Family Calmodulin-like 0.000000489
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|17986258|ref|NP_066299.2|
Sequence length 151
Comment myosin light polypeptide 6 isoform 1 [Homo sapiens]
Sequence
MCDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEM
NVKVLDFEHFLPMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKM
TEEEVEMLVAGHEDSNGCINYEAFVRHILSG
Download sequence
Identical sequences A0A0P6J1F8 A0A1S3ADP4 A0A1S3FKA3 A0A1U7R5E2 A0A2J8UHY3 A0A2K5F026 A0A2K5MIA7 A0A2K5RYX2 A0A2K5TNH7 A0A2K6FLM6 A0A2K6KHW1 F6TSQ1 F7AX54 G1TKL2 G3HRQ4 G3QL74 H2Q679 H9YV18 P60660 P60661 P60662 Q5R844 Q60605
ENSOCUP00000017498 gi|17986258|ref|NP_066299.2| ENSMMUP00000013787 ENSBTAP00000014306 ENSMMUP00000039421 ENSOCUP00000017498 ENSP00000446955 ENSP00000448101 ENSSSCP00000000403 ENSSSCP00000000412 ENSSSCP00000000403 ENSSSCP00000000412 ENSTTRP00000015562 ENSECAP00000016002 NP_001126203.1.23681 NP_001157469.1.46622 NP_001180478.1.72884 NP_001304147.1.92730 NP_066299.2.87134 NP_066299.2.92137 NP_786974.1.59421 NP_786974.1.76553 XP_002916027.1.58354 XP_003365312.1.31192 XP_003476238.1.53824 XP_003790563.1.62490 XP_003824985.1.60992 XP_003988930.1.62641 XP_004006639.1.66739 XP_004053403.1.27298 XP_004401717.1.74151 XP_004429293.1.5094 XP_004429294.1.5094 XP_004589717.1.84141 XP_004647134.1.9945 XP_004650030.1.11716 XP_004700619.1.18182 XP_005079771.1.91757 XP_005335681.1.77405 XP_005371244.1.66349 XP_005397349.1.28644 XP_005550127.1.63531 XP_005680422.1.57651 XP_005876791.1.60319 XP_005903488.1.15283 XP_006075109.1.26621 XP_006093717.1.53796 XP_006165661.1.99106 XP_006179896.1.101512 XP_006218632.1.17985 XP_006728838.1.47382 XP_006777916.1.95426 XP_006777918.1.95426 XP_006859479.1.41390 XP_006908951.1.64745 XP_006987396.1.50099 XP_007081553.1.5354 XP_007129416.1.24612 XP_007179632.1.59432 XP_007467796.1.90284 XP_007533403.1.11023 XP_007633759.1.28591 XP_007644884.1.69978 XP_007953301.1.48129 XP_008146846.1.99482 XP_008254865.1.1745 XP_008528367.1.77740 XP_008575389.1.73410 XP_008710513.1.72690 XP_008763262.1.100692 XP_008846928.1.79516 XP_009002217.1.60252 XP_010596258.1.64505 XP_010643014.1.5607 XP_010837518.1.44457 XP_010962173.1.22495 XP_010975178.1.51371 XP_011373996.1.92234 XP_011918864.1.92194 XP_012016089.1.54773 XP_012305874.1.9421 XP_012383583.1.11602 XP_012412022.1.4749 XP_012506701.1.63892 XP_012609172.1.48125 XP_012876459.1.60039 XP_012901630.1.14098 XP_012933740.1.39548 XP_014699366.1.49734 XP_014940605.1.86478 XP_015338719.1.40921 XP_016021264.1.101085 XP_016079960.1.3490 XP_016778706.1.37143 XP_017391789.1.71028 XP_017517436.1.32401 XP_017708737.1.44346 XP_019310295.1.44245 XP_019524648.1.44202 XP_019597854.1.88060 XP_019816613.1.53367 XP_020018831.1.5219 XP_020739850.1.74333 XP_021060398.1.100879 XP_021510470.1.76796 XP_021542852.1.83697 XP_856750.2.84170 ENSBTAP00000014304 9544.ENSMMUP00000039421 9796.ENSECAP00000016002 9913.ENSBTAP00000014304 ENSDNOP00000020739 ENSCJAP00000021369 ENSTTRP00000015562 ENSDORP00000001019 ENSPANP00000000555 ENSP00000446955 ENSP00000448101 ENSDORP00000001019 ENSGGOP00000003219 ENSECAP00000016002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]