SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|17986273|ref|NP_524144.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17986273|ref|NP_524144.1|
Domain Number 1 Region: 47-192
Classification Level Classification E-value
Superfamily EF-hand 2.82e-37
Family Calmodulin-like 0.00000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|17986273|ref|NP_524144.1|
Sequence length 194
Comment myosin light chain 1/3, skeletal muscle isoform isoform 1f [Homo sapiens]
Sequence
MAPKKDVKKPVAAAAAAPAPAPAPAPAPAPAKPKEEKIDLSAIKIEFSKEQQDEFKEAFL
LFDRTGDSKITLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELNAKKIEFEQFLPMMQAI
SNNKDQATYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALMAGQEDSNG
CINYEAFVKHIMSI
Download sequence
Identical sequences P05976
ENSP00000307280 NP_524144.1.87134 NP_524144.1.92137 gi|17986273|ref|NP_524144.1| ENSP00000307280 9606.ENSP00000307280 ENSP00000343321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]