SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|17986275|ref|NP_524146.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17986275|ref|NP_524146.1|
Domain Number 1 Region: 3-148
Classification Level Classification E-value
Superfamily EF-hand 9.88e-38
Family Calmodulin-like 0.00000155
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|17986275|ref|NP_524146.1|
Sequence length 150
Comment myosin light chain 1/3, skeletal muscle isoform isoform 3f [Homo sapiens]
Sequence
MSFSADQIAEFKEAFLLFDRTGDSKITLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELN
AKKIEFEQFLPMMQAISNNKDQATYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMK
EEEVEALMAGQEDSNGCINYEAFVKHIMSI
Download sequence
Identical sequences G3S5Q0 H2QJC1
ENSPTRP00000022019 gi|17986275|ref|NP_524146.1| NP_524146.1.87134 NP_524146.1.92137 XP_004033192.1.27298 XP_004033194.1.27298 XP_008957242.1.60992 XP_008957243.1.60992 XP_016805911.1.37143 hsi002007150.1 ENSP00000343321 ENSP00000343321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]