SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|18079218|ref|NP_065892.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|18079218|ref|NP_065892.1|
Domain Number 1 Region: 399-789
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 3.01e-128
Family Oxysterol-binding protein 0.0000346
Further Details:      
 
Domain Number 2 Region: 27-114,145-265
Classification Level Classification E-value
Superfamily PH domain-like 2.17e-24
Family Pleckstrin-homology domain (PH domain) 0.00000275
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|18079218|ref|NP_065892.1|
Sequence length 889
Comment oxysterol-binding protein-related protein 8 isoform a [Homo sapiens]
Sequence
MEGGLADGEPDRTSLLGDSKDVLGPSTVVANSDESQLLTPGKMSQRQGKEAYPTPTKDLH
QPSLSPASPHSQGFERGKEDISQNKDESSLSMSKSKSESKLYNGSEKDSSTSSKLTKKES
LKVQKKNYREEKKRATKELLSTITDPSVIVMADWLKIRGTLKSWTKLWCVLKPGVLLIYK
TQKNGQWVGTVLLNACEIIERPSKKDGFCFKLFHPLEQSIWAVKGPKGEAVGSITQPLPS
SYLIIRATSESDGRCWMDALELALKCSSLLKRTMIREGKEHDLSVSSDSTHVTFYGLLRA
NNLHSGDNFQLNDSEIERQHFKDQDMYSDKSDKENDQEHDESDNEVMGKSEESDTDTSER
QDDSYIEPEPVEPLKETTYTEQSHEELGEAGEASQTETVSEENKSLIWTLLKQVRPGMDL
SKVVLPTFILEPRSFLDKLSDYYYHADFLSEAALEENPYFRLKKVVKWYLSGFYKKPKGL
KKPYNPILGETFRCLWIHPRTNSKTFYIAEQVSHHPPISAFYVSNRKDGFCLSGSILAKS
KFYGNSLSAILEGEARLTFLNRGEDYVMTMPYAHCKGILYGTMTLELGGTVNITCQKTGY
SAILEFKLKPFLGSSDCVNQISGKLKLGKEVLATLEGHWDSEVFITDKKTDNSEVFWNPT
PDIKQWRLIRHTVKFEEQGDFESEKLWQRVTRAINAKDQTEATQEKYVLEEAQRQAARDR
KTKNEEWSCKLFELDPLTGEWHYKFADTRPWDPLNDMIQFEKDGVIQTKVKHRTPMVSVP
KMKHKPTRQQKKVAKGYSSPEPDIQDSSGSEAQSVKPSTRRKKGIELGDIQSSIESIKQT
QEEIKRNIMALRNHLVSSTPATDYFLQQKDYFIIFLLILLQVIINFMFK
Download sequence
Identical sequences A0A024RBB8 H2Q6I6 Q9BZF1
9598.ENSPTRP00000008904 9606.ENSP00000261183 ENSP00000261183 gi|18079218|ref|NP_065892.1| ENSP00000261183 ENSPTRP00000008904 ENSPTRP00000008904 ENSP00000261183 ENSGGOP00000015750 NP_065892.1.87134 NP_065892.1.92137 XP_003832932.1.60992 XP_005268678.1.92137 XP_509228.3.37143 ENSGGOP00000024179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]