SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|18104964|ref|NP_542157.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|18104964|ref|NP_542157.1|
Domain Number 1 Region: 23-161
Classification Level Classification E-value
Superfamily EF-hand 1.21e-28
Family Calmodulin-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|18104964|ref|NP_542157.1|
Sequence length 162
Comment calcyphosin isoform b [Homo sapiens]
Sequence
MDAVDATMEKLRAQCLSRGASGIQGLARFFRQLDRDGSRSLDADEFRQGLAKLGLVLDQA
EAEGVCRKWDRNGSGTLDLEEFLRALRPPMSQAREAVIAAAFAKLDRSGDGVVTVDDLRG
VYSGRAHPKVTLAEFQDYYSGVSASMNTDEEFVAMMTSAWQL
Download sequence
Identical sequences ENSP00000403263 ENSP00000403263 gi|18104964|ref|NP_542157.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]