SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|18104969|ref|NP_542158.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|18104969|ref|NP_542158.1|
Domain Number 1 Region: 73-544
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 4.94e-178
Family Myeloperoxidase-like 0.0000000000000238
Further Details:      
 
Domain Number 2 Region: 32-70
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000156
Family EGF-type module 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|18104969|ref|NP_542158.1|
Sequence length 562
Comment prostaglandin G/H synthase 1 isoform 2 precursor [Homo sapiens]
Sequence
MSRSLLLWFLLFLLLLPPLPVLLADPGAPTPVNPCCYYPCQHQGICVRFGLDRYQCDCTR
TGYSGPNCTIPGLWTWLRNSLRPSPSFTHFLLTHGRWFWEFVNATFIREMLMRLVLTVRS
NLIPSPPTYNSAHDYISWESFSNVSYYTRILPSVPKDCPTPMGTKGKKQLPDAQLLARRF
LLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQ
YQLRLFKDGKLKYQVLDGEMYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMLY
ATLWLREHNRVCDLLKAEHPTWGDEQLFQTTRLILIGETIKIVIEEYVQQLSGYFLQLKF
DPELLFGVQFQYRNRIAMEFNHLYHWHPLMPDSFKIGGGRNMDHHILHVAVDVIRESREM
RLQPFNEYRKRFGMKPYTSFQELVGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIF
GESMIEIGAPFSLKGLLGNPICSPEYWKPSTFGGEVGFNIVKTATLKKLVCLNTKTCPYV
SFRVPDASQDDGPAVERPSTEL
Download sequence
Identical sequences gi|18104969|ref|NP_542158.1| ENSP00000223423 NP_542158.1.87134 NP_542158.1.92137 ENSP00000223423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]