SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|18105012|ref|NP_057169.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|18105012|ref|NP_057169.2|
Domain Number - Region: 17-67
Classification Level Classification E-value
Superfamily L domain-like 0.000408
Family Internalin LRR domain 0.047
Further Details:      
 
Domain Number - Region: 103-135
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00907
Family EGF-type module 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|18105012|ref|NP_057169.2|
Sequence length 171
Comment apoptosis-related protein 3 isoform a [Homo sapiens]
Sequence
MLHARCCLNQKGTILGLDLQNCSLEDPGPNFHQAHTTVIIDLQANPLKGDLANTFRGFTQ
LQTLILPQHVNCPGGINAWNTITSYIDNQICQGQKNLCNNTGDPEMCPENGSCVPDGPGL
LQCVCADGFHGYKCMRQGSFSLLMFFGILGATTLSVSILLWATQRRKAKTS
Download sequence
Identical sequences ENSP00000384033 gi|18105012|ref|NP_057169.2| NP_057169.2.87134 NP_057169.2.92137 ENSP00000384033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]