SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|181336739|ref|NP_115821.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|181336739|ref|NP_115821.2|
Domain Number - Region: 796-829
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00073
Family EGF-type module 0.03
Further Details:      
 
Domain Number - Region: 362-409
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000766
Family Laminin-type module 0.016
Further Details:      
 
Domain Number - Region: 749-798
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0167
Family EGF-type module 0.085
Further Details:      
 
Domain Number - Region: 446-495
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0327
Family Laminin-type module 0.05
Further Details:      
 
Domain Number - Region: 230-259
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0407
Family Laminin-type module 0.029
Further Details:      
 
Domain Number - Region: 575-622
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0434
Family Laminin-type module 0.043
Further Details:      
 
Domain Number - Region: 142-191
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0456
Family Laminin-type module 0.062
Further Details:      
 
Domain Number - Region: 275-320
Classification Level Classification E-value
Superfamily EGF/Laminin 0.061
Family EGF-type module 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|181336739|ref|NP_115821.2|
Sequence length 1044
Comment multiple epidermal growth factor-like domains protein 11 precursor [Homo sapiens]
Sequence
MVLSLTGLIAFSFLQATLALNPEDPNVCSHWESYAVTVQESYAHPFDQIYYTRCTDILNW
FKCTRHRISYKTAYRRGLRTMYRRRSQCCPGYYESGDFCIPLCTEECVHGRCVSPDTCHC
EPGWGGPDCSSGCDSDHWGPHCSNRCQCQNGALCNPITGACVCAAGFRGWRCEELCAPGT
HGKGCQLPCQCRHGASCDPRAGECLCAPGYTGVYCEELCPPGSHGAHCELRCPCQNGGTC
HHITGECACPPGWTGAVCAQPCPPGTFGQNCSQDCPCHHGGQCDHVTGQCHCTAGYMGDR
CQEECPFGSFGFQCSQHCDCHNGGQCSPTTGACECEPGYKGPRCQERLCPEGLHGPGCTL
PCPCDADNTISCHPVTGACTCQPGWSGHHCNESCPVGYYGDGCQLPCTCQNGADCHSITG
GCTCAPGFMGEVCAVSCAAGTYGPNCSSICSCNNGGTCSPVDGSCTCKEGWQGLDCTLPC
PSGTWGLNCNESCTCANGAACSPIDGSCSCTPGWLGDTCELPCPDGTFGLNCSEHCDCSH
ADGCDPVTGHCCCLAGWTGIRCDSTCPPGRWGPNCSVSCSCENGGSCSPEDGSCECAPGF
RGPLCQRICPPGFYGHGCAQPCPLCVHSSRPCHHISGICECLPGFSGALCNQVCAGGYFG
QDCAQLCSCANNGTCSPIDGSCQCFPGWIGKDCSQACPPGFWGPACFHACSCHNGASCSA
EDGACHCTPGWTGLFCTQRCPAAFFGKDCGRVCQCQNGASCDHISGKCTCRTGFTGQHCE
QRCAPGTFGYGCQQLCECMNNSTCDHVTGTCYCSPGFKGIRCDQAALMMEELNPYTKISP
ALGAERHSVGAVTGIMLLLFLIVVLLGLFAWHRRRQKEKGRDLAPRVSYTPAMRMTSTDY
SLSGACGMDRRQNTYIMDKGFKDYMKESVCSSSTCSLNSSENPYATIKDPPILTCKLPES
SYVEMKSPVHMGSPYTDVPSLSTSNKNIYEVEPTVSVVQEGCGHNSSYIQNAYDLPRNSH
IPGHYDLLPVRQSPANGPSQDKQS
Download sequence
Identical sequences A6BM72
ENSP00000288745 ENSP00000458362 gi|181336739|ref|NP_115821.2| 9606.ENSP00000386908 ENSP00000386908 ENSP00000414475 ENSP00000459000 NP_115821.2.87134 NP_115821.2.92137 XP_016878161.1.92137 ENSP00000386908 ENSP00000414475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]