SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|18497288|ref|NP_066548.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|18497288|ref|NP_066548.2|
Domain Number 1 Region: 911-980
Classification Level Classification E-value
Superfamily TB module/8-cys domain 7.59e-21
Family TB module/8-cys domain 0.0000687
Further Details:      
 
Domain Number 2 Region: 399-462
Classification Level Classification E-value
Superfamily TB module/8-cys domain 9.68e-18
Family TB module/8-cys domain 0.00046
Further Details:      
 
Domain Number 3 Region: 789-910
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.43e-17
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 4 Region: 676-786
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000251
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 5 Region: 575-702
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000753
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 6 Region: 1085-1139
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000942
Family TB module/8-cys domain 0.0019
Further Details:      
 
Domain Number 7 Region: 273-350
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000000445
Family TB module/8-cys domain 0.003
Further Details:      
 
Domain Number 8 Region: 348-395
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000279
Family EGF-type module 0.0031
Further Details:      
 
Domain Number 9 Region: 1174-1215
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000054
Family EGF-type module 0.007
Further Details:      
 
Domain Number 10 Region: 992-1041
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000106
Family EGF-type module 0.011
Further Details:      
 
Domain Number 11 Region: 1032-1076
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000368
Family EGF-type module 0.006
Further Details:      
 
Domain Number 12 Region: 1201-1251
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000318
Family EGF-type module 0.01
Further Details:      
 
Domain Number 13 Region: 113-142
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000289
Family EGF-type module 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|18497288|ref|NP_066548.2|
Sequence length 1256
Comment latent-transforming growth factor beta-binding protein 3 isoform 2 precursor [Homo sapiens]
Sequence
MPGPRGAAGGLAPEMRGAGAAGLLALLLLLLLLLLGLGGRVEGGPAGERGAGGGGALARE
RFKVVFAPVICKRTCLKGQCRDSCQQGSNMTLIGENGHSTDTLTGSGFRVVVCPLPCMNG
GQCSSRNQCLCPPDFTGRFCQVPAGGAGGGTGGSGPGLSRTGALSTGALPPLAPEGDSVA
SKHAIYAVQVIADPPGPGEGPPAQHAAFLVPLGPGQISAEVQAPPPVVNVRVHHPPEASV
QVHRIESSNAESAAPSQHLLPHPKPSHPRPPTQKPLGRCFQDTLPKQPCGSNPLPGLTKQ
EDCCGSIGTAWGQSKCHKCPQLQYTGVQKPGPVRGEVGADCPQGYKRLNSTHCQDINECA
MPGVCRHGDCLNNPGSYRCVCPPGHSLGPSRTQCIADKPEEKSLCFRLVSPEHQCQHPLT
TRLTRQLCCCSVGKAWGARCQRCPTDGTAAFKEICPAGKGYHILTSHQTLTIQGESDFSL
FLHPDGPPKPQQLPESPSQAPPPEDTEEERGVTTDSPVSEERSVQQSHPTATTTPARPYP
ELISRPSPPTMRWFLPDLPPSRSAVEIAPTQVTETDECRLNQNICGHGECVPGPPDYSCH
CNPGYRSHPQHRYCVDVNECEAEPCGPGRGICMNTGGSYNCHCNRGYRLHVGAGGRSCVD
LNECAKPHLCGDGGFCINFPGHYKCNCYPGYRLKASRPPVCEDIDECRDPSSCPDGKCEN
KPGSFKCIACQPGYRSQGGGACRDVNECAEGSPCSPGWCENLPGSFRCTCAQGYAPAPDG
RSCLDVDECEAGDVCDNGICSNTPGSFQCQCLSGYHLSRDRSHCEDIDECDFPAACIGGD
CINTNGSYRCLCPQGHRLVGGRKCQDIDECSQDPSLCLPHGACKNLQGSYVCVCDEGFTP
TQDQHGCEEVEQPHHKKECYLNFDDTVFCDSVLATNVTQQECCCSLGAGWGDHCEIYPCP
VYSSAEFHSLCPDGKGYTQDNNIVNYGIPAHRDIDECMLFGSEICKEGKCVNTQPGYECY
CKQGFYYDGNLLECVDVDECLDESNCRNGVCENTRGGYRCACTPPAEYSPAQRQCLSPEE
MERAPERRDVCWSQRGEDGMCAGPLAGPALTFDDCCCRQGRGWGAQCRPCPPRGAGSHCP
TSQSESNSFWDTSPLLLGKPPRDEDSSEEDSDECRCVSGRCVPRPGGAVCECPGGFQLDA
SRARCVDIDECRELNQRGLLCKSERCVNTSGSFRCVCKAGFARSRPHGACVPQRRR
Download sequence
Identical sequences ENSP00000326647 ENSP00000326647 gi|18497288|ref|NP_066548.2| NP_066548.2.87134 NP_066548.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]