SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|18699732|ref|NP_057260.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|18699732|ref|NP_057260.2|
Domain Number 1 Region: 193-356
Classification Level Classification E-value
Superfamily EF-hand 1.06e-22
Family Calmodulin-like 0.021
Further Details:      
 
Domain Number 2 Region: 96-164
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000253
Family Polcalcin 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|18699732|ref|NP_057260.2|
Sequence length 362
Comment 45 kDa calcium-binding protein isoform 2 precursor [Homo sapiens]
Sequence
MVWPWVAMASRWGPLIGLAPCCLWLLGAVLLMDASARPANHSSTRERVANREENEILPPD
HLNGVKLEMDGHLNRGFHQEVFLGKDLGGFDEDAEPRRSRRKLMVIFSKVDVNTDRKISA
KEMQRWIMEKTAEHFQEAMEESKTHFRAVDPDGDGHVSWDEYKVKFLASKGHSEKEVADA
IRLNEELKVDEETQEVLENLKDRWYQADSPPADLLLTEEEFLSFLHPEHSRGMLRFMVKE
IVRDLDQDGDKQLSVPEFISLPVGTVENQQGQDIDDNWVKDRKKEFEELIDSNHDGIVTA
EELESYMDPMNEYNALNEAKQMIAVADENQNHHLEPEEVLKYSEFFTGSKLVDYARSVHE
EF
Download sequence
Identical sequences A0A024R084 Q9BRK5
ENSP00000263741 NYSGRC-18699732 ENSP00000353094 9606.ENSP00000353094 gi|18699732|ref|NP_057260.2| ENSP00000353094 NP_057260.2.87134 NP_057260.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]