SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|187608516|ref|NP_036419.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|187608516|ref|NP_036419.3|
Domain Number 1 Region: 4-289
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 8.58e-81
Family BAR domain 0.00063
Further Details:      
 
Domain Number 2 Region: 400-515
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 3.27e-42
Family Pyk2-associated protein beta ARF-GAP domain 0.00016
Further Details:      
 
Domain Number 3 Region: 260-365
Classification Level Classification E-value
Superfamily PH domain-like 3.6e-28
Family Pleckstrin-homology domain (PH domain) 0.0036
Further Details:      
 
Domain Number 4 Region: 610-728
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.07e-25
Family Ankyrin repeat 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|187608516|ref|NP_036419.3|
Sequence length 778
Comment arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 [Homo sapiens]
Sequence
MKMTVDFEECLKDSPRFRAALEEVEGDVAELELKLDKLVKLCIAMIDTGKAFCVANKQFM
NGIRDLAQYSSNDAVVETSLTKFSDSLQEMINFHTILFDQTQRSIKAQLQNFVKEDLRKF
KDAKKQFEKVSEEKENALVKNAQVQRNKQHEVEEATNILTATRKCFRHIALDYVLQINVL
QSKRRSEILKSMLSFMYAHLAFFHQGYDLFSELGPYMKDLGAQLDRLVVDAAKEKREMEQ
KHSTIQQKDFSSDDSKLEYNVDAANGIVMEGYLFKRASNAFKTWNRRWFSIQNNQLVYQK
KFKDNPTVVVEDLRLCTVKHCEDIERRFCFEVVSPTKSCMLQADSEKLRQAWIKAVQTSI
ATAYREKGDESEKLDKKSSPSTGSLDSGNESKEKLLKGESALQRVQCIPGNASCCDCGLA
DPRWASINLGITLCIECSGIHRSLGVHFSKVRSLTLDTWEPELLKLMCELGNDVINRVYE
ANVEKMGIKKPQPGQRQEKEAYIRAKYVERKFVDKYSISLSPPEQQKKFVSKSSEEKRLS
ISKFGPGDQVRASAQSSVRSNDSGIQQSSDDGRESLPSTVSANSLYEPEGERQDSSMFLD
SKHLNPGLQLYRASYEKNLPKMAEALAHGADVNWANSEENKATPLIQAVLGGSLVTCEFL
LQNGANVNQRDVQGRGPLHHATVLGHTGQVCLFLKRGANQHATDEEGKDPLSIAVEAANA
DIVTLLRLARMNEEMRESEGLYGQPGDETYQDIFRDFSQMASNNPEKLNRFQQDSQKF
Download sequence
Identical sequences A0A2I3HHG2 H2QP05 Q15057
9598.ENSPTRP00000027113 9606.ENSP00000324287 ENSP00000324287 NP_036419.3.87134 NP_036419.3.92137 XP_003280469.1.23891 XP_003807688.1.60992 XP_516962.3.37143 ENSNLEP00000010182 ENSP00000324287 gi|187608516|ref|NP_036419.3| ENSPTRP00000027113 ENSPTRP00000027113 ENSP00000324287 ENSNLEP00000010182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]