SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|18765700|ref|NP_055615.8| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|18765700|ref|NP_055615.8|
Domain Number 1 Region: 548-673
Classification Level Classification E-value
Superfamily PH domain-like 1.55e-19
Family Pleckstrin-homology domain (PH domain) 0.026
Further Details:      
 
Domain Number 2 Region: 85-157,194-262
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000134
Family HspBP1 domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|18765700|ref|NP_055615.8|
Sequence length 727
Comment engulfment and cell motility protein 1 isoform 1 [Homo sapiens]
Sequence
MPPPADIVKVAIEWPGAYPKLMEIDQKKPLSAIIKEVCDGWSLANHEYFALQHADSSNFY
ITEKNRNEIKNGTILRLTTSPAQNAQQLHERIQSSSMDAKLEALKDLASLSRDVTFAQEF
INLDGISLLTQMVESGTERYQKLQKIMKPCFGDMLSFTLTAFVELMDHGIVSWDTFSVAF
IKKIASFVNKSAIDISILQRSLAILESMVLNSHDLYQKVAQEITIGQLIPHLQGSDQEIQ
TYTIAVINALFLKAPDERRQEMANILAQKQLRSIILTHVIRAQRAINNEMAHQLYVLQVL
TFNLLEDRMMTKMDPQDQAQRDIIFELRRIAFDAESEPNNSSGSMEKRKSMYTRDYKKLG
FINHVNPAMDFTQTPPGMLALDNMLYFAKHHQDAYIRIVLENSSREDKHECPFGRSSIEL
TKMLCEILKVGELPSETCNDFHPMFFTHDRSFEEFFCICIQLLNKTWKEMRATSEDFNKV
MQVVKEQVMRALTTKPSSLDQFKSKLQNLSYTEILKIRQSERMNQEDFQSRPILELKEKI
QPEILELIKQQRLNRLVEGTCFRKLNARRRQDKFWYCRLSPNHKVLHYGDLEESPQGEVP
HDSLQDKLPVADIKAVVTGKDCPHMKEKGALKQNKEVLELAFSILYDSNCQLNFIAPDKH
EYCIWTDGLNALLGKDMMSDLTRNDLDTLLSMEIKLRLLDLENIQIPDAPPPIPKEPSNY
DFVYDCN
Download sequence
Identical sequences A0A2K5CYV2 A0A2K5R0D9 A0A2K6U603 A4D1X5 F7IAL7 G1QQ57 H2QUF7 Q92556
ENSPTRP00000032609 9598.ENSPTRP00000032609 9606.ENSP00000312185 ENSCJAP00000022958 ENSPTRP00000032609 ENSP00000312185 NP_001193409.1.87134 NP_001193409.1.92137 NP_001193411.1.87134 NP_001193411.1.92137 NP_055615.8.87134 NP_055615.8.92137 XP_001170197.1.37143 XP_002751381.1.60252 XP_002751382.1.60252 XP_003268985.1.23891 XP_003268987.1.23891 XP_003268988.1.23891 XP_003318309.1.37143 XP_003815020.1.60992 XP_003815021.1.60992 XP_003930794.1.74449 XP_003930795.1.74449 XP_003930796.1.74449 XP_003951034.1.37143 XP_005249976.1.92137 XP_006715868.1.92137 XP_011513956.1.92137 XP_016868327.1.92137 XP_016868328.1.92137 XP_017357720.1.71028 XP_017830611.1.60252 XP_017830612.1.60252 XP_021525033.1.9421 ENSNLEP00000003075 ENSCJAP00000022958 ENSP00000312185 ENSP00000394458 ENSP00000406952 gi|18765700|ref|NP_055615.8| gi|330688434|ref|NP_001193409.1| gi|330688436|ref|NP_001193411.1| ENSNLEP00000003075 HR3358 ENSP00000312185 ENSP00000394458 ENSP00000406952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]