SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|188497618|ref|NP_006305.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|188497618|ref|NP_006305.2|
Domain Number 1 Region: 330-495
Classification Level Classification E-value
Superfamily PH domain-like 1.82e-37
Family Pleckstrin-homology domain (PH domain) 0.0014
Further Details:      
 
Domain Number 2 Region: 1-76
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000456
Family SAM (sterile alpha motif) domain 0.000016
Further Details:      
 
Domain Number 3 Region: 176-275
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000374
Family PDZ domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|188497618|ref|NP_006305.2|
Sequence length 713
Comment connector enhancer of kinase suppressor of ras 1 [Homo sapiens]
Sequence
MEPVETWTPGKVATWLRGLDDSLQDYPFEDWQLPGKNLLQLCPQSLEALAVRSLGHQELI
LGGVEQLQALSSRLQTENLQSLTEGLLGATHDFQSIVQGCLGDCAKTPIDVLCAAVELLH
EADALLFWLSRYLFSHLNDFSACQEIRDLLEELSQVLHEDGPAAEKEGTVLRICSHVAGI
CHNILVCCPKELLEQKAVLEQVQLDSPLGLEIHTTSNCQHFVSQVDTQVPTDSRLQIQPG
DEVVQINEQVVVGWPRKNMVRELLREPAGLSLVLKKIPIPETPPQTPPQVLDSPHQRSPS
LSLAPLSPRAPSEDVFAFDLSSNPSPGPSPAWTDSASLGPEPLPIPPEPPAILPAGVAGT
PGLPESPDKSPVGRKKSKGLATRLSRRRVSCRELGRPDCDGWLLLRKAPGGFMGPRWRRR
WFVLKGHTLYWYRQPQDEKAEGLINVSNYSLESGHDQKKKYVFQLTHDVYKPFIFAADTL
TDLSMWVRHLITCISKYQSPGRAPPPREEDCYSETEAEDPDDEAGSHSASPSPAQAGSPL
HGDTSPAATPTQRSPRTSFGSLTDSSEEALEGMVRGLRQGGVSLLGQPQPLTQEQWRSSF
MRRNRDPQLNERVHRVRALQSTLKAKLQELQVLEEVLGDPELTGEKFRQWKEQNRELYSE
GLGAWGVAQAEGSSHILTSDSTEQSPHSLPSDPEEHSHLCPLTSESSLRPPDL
Download sequence
Identical sequences Q53GM7
ENSP00000354609 gi|188497618|ref|NP_006305.2| NP_006305.2.87134 NP_006305.2.92137 9606.ENSP00000354609 ENSP00000354609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]