SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|188528648|ref|NP_061978.6| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|188528648|ref|NP_061978.6|
Domain Number 1 Region: 4023-4236
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 2.49e-77
Family Fibrinogen C-terminal domain-like 0.00000284
Further Details:      
 
Domain Number 2 Region: 1062-1230
Classification Level Classification E-value
Superfamily Fibronectin type III 3.51e-19
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 3 Region: 3753-3841
Classification Level Classification E-value
Superfamily Fibronectin type III 2.83e-18
Family Fibronectin type III 0.0001
Further Details:      
 
Domain Number 4 Region: 3841-4003
Classification Level Classification E-value
Superfamily Fibronectin type III 5e-18
Family Fibronectin type III 0.0000042
Further Details:      
 
Domain Number 5 Region: 1478-1648
Classification Level Classification E-value
Superfamily Fibronectin type III 6.44e-18
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 6 Region: 2838-2928
Classification Level Classification E-value
Superfamily Fibronectin type III 1.44e-17
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 7 Region: 1990-2073
Classification Level Classification E-value
Superfamily Fibronectin type III 2.16e-17
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 8 Region: 2307-2389
Classification Level Classification E-value
Superfamily Fibronectin type III 5.47e-17
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 9 Region: 3061-3144
Classification Level Classification E-value
Superfamily Fibronectin type III 6.64e-17
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 10 Region: 3164-3250
Classification Level Classification E-value
Superfamily Fibronectin type III 7.63e-17
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 11 Region: 2408-2497
Classification Level Classification E-value
Superfamily Fibronectin type III 7.71e-17
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 12 Region: 2631-2714
Classification Level Classification E-value
Superfamily Fibronectin type III 1.11e-16
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 13 Region: 3445-3533
Classification Level Classification E-value
Superfamily Fibronectin type III 1.35e-16
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 14 Region: 2732-2822
Classification Level Classification E-value
Superfamily Fibronectin type III 1.64e-16
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 15 Region: 2946-3036
Classification Level Classification E-value
Superfamily Fibronectin type III 2.3e-16
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 16 Region: 3355-3439
Classification Level Classification E-value
Superfamily Fibronectin type III 2.3e-16
Family Fibronectin type III 0.0019
Further Details:      
 
Domain Number 17 Region: 2517-2608
Classification Level Classification E-value
Superfamily Fibronectin type III 3.12e-16
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 18 Region: 2099-2181
Classification Level Classification E-value
Superfamily Fibronectin type III 3.61e-16
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 19 Region: 3558-3640
Classification Level Classification E-value
Superfamily Fibronectin type III 3.78e-16
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 20 Region: 1673-1759
Classification Level Classification E-value
Superfamily Fibronectin type III 7.05e-16
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 21 Region: 3656-3749
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000131
Family Fibronectin type III 0.00000201
Further Details:      
 
Domain Number 22 Region: 2198-2280
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000141
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 23 Region: 1265-1347
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000182
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 24 Region: 838-926
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000206
Family Fibronectin type III 0.00041
Further Details:      
 
Domain Number 25 Region: 1373-1458
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000476
Family Fibronectin type III 0.0021
Further Details:      
 
Domain Number 26 Region: 1774-1862
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000175
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 27 Region: 3266-3353
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000232
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 28 Region: 1885-1967
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000873
Family Fibronectin type III 0.003
Further Details:      
 
Domain Number 29 Region: 757-838
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000476
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 30 Region: 959-1039
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000446
Family Fibronectin type III 0.0031
Further Details:      
 
Weak hits

Sequence:  gi|188528648|ref|NP_061978.6|
Domain Number - Region: 624-649
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00134
Family Integrin beta EGF-like domains 0.039
Further Details:      
 
Domain Number - Region: 253-277
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00391
Family Integrin beta EGF-like domains 0.029
Further Details:      
 
Domain Number - Region: 284-308
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00474
Family Integrin beta EGF-like domains 0.039
Further Details:      
 
Domain Number - Region: 377-401
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00753
Family Integrin beta EGF-like domains 0.045
Further Details:      
 
Domain Number - Region: 315-339
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00753
Family Integrin beta EGF-like domains 0.07
Further Details:      
 
Domain Number - Region: 191-215
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00893
Family EGF-type module 0.063
Further Details:      
 
Domain Number - Region: 532-556
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00893
Family Integrin beta EGF-like domains 0.067
Further Details:      
 
Domain Number - Region: 470-494
Classification Level Classification E-value
Superfamily EGF/Laminin 0.019
Family Integrin beta EGF-like domains 0.047
Further Details:      
 
Domain Number - Region: 439-463
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0215
Family Integrin beta EGF-like domains 0.059
Further Details:      
 
Domain Number - Region: 594-618
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0237
Family EGF-type module 0.041
Further Details:      
 
Domain Number - Region: 408-431
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0307
Family Integrin beta EGF-like domains 0.07
Further Details:      
 
Domain Number - Region: 501-524
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0586
Family Integrin beta EGF-like domains 0.062
Further Details:      
 
Domain Number - Region: 345-370
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0642
Family EGF-type module 0.087
Further Details:      
 
Domain Number - Region: 222-246
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0837
Family EGF-type module 0.071
Further Details:      
 
Domain Number - Region: 563-587
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0921
Family EGF-type module 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|188528648|ref|NP_061978.6|
Sequence length 4242
Comment tenascin-X isoform 1 precursor [Homo sapiens]
Sequence
MMPAQYALTSSLVLLVLLSTARAGPFSSRSNVTLPAPRPPPQPGGHTVGAGVGSPSSQLY
EHTVEGGEKQVVFTHRINLPPSTGCGCPPGTEPPVLASEVQALRVRLEILEELVKGLKEQ
CTGGCCPASAQAGTGQTDVRTLCSLHGVFDLSRCTCSCEPGWGGPTCSDPTDAEIPPSSP
PSASGSCPDDCNDQGRCVRGRCVCFPGYTGPSCGWPSCPGDCQGRGRCVQGVCVCRAGFS
GPDCSQRSCPRGCSQRGRCEGGRCVCDPGYTGDDCGMRSCPRGCSQRGRCENGRCVCNPG
YTGEDCGVRSCPRGCSQRGRCKDGRCVCDPGYTGEDCGTRSCPWDCGEGGRCVDGRCVCW
PGYTGEDCSTRTCPRDCRGRGRCEDGECICDTGYSGDDCGVRSCPGDCNQRGRCEDGRCV
CWPGYTGTDCGSRACPRDCRGRGRCENGVCVCNAGYSGEDCGVRSCPGDCRGRGRCESGR
CMCWPGYTGRDCGTRACPGDCRGRGRCVDGRCVCNPGFTGEDCGSRRCPGDCRGHGLCED
GVCVCDAGYSGEDCSTRSCPGGCRGRGQCLDGRCVCEDGYSGEDCGVRQCPNDCSQHGVC
QDGVCICWEGYVSEDCSIRTCPSNCHGRGRCEEGRCLCDPGYTGPTCATRMCPADCRGRG
RCVQGVCLCHVGYGGEDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGPDCAIQTCP
GDCRGRGECHDGSCVCKDGYAGEDCGEEVPTIEGMRMHLLEETTVRTEWTPAPGPVDAYE
IQFIPTTEGASPPFTARVPSSASAYDQRGLAPGQEYQVTVRALRGTSWGLPASKTITTMI
DGPQDLRVVAVTPTTLELGWLRPQAEVDRFVVSYVSAGNQRVRLEVPPEADGTLLTDLMP
GVEYVVTVTAERGRAVSYPASVRANTGSSPLGLLGTTDEPPPSGPSTTQGAQAPLLQQRP
QELGELRVLGRDETGRLRVVWTAQPDTFAYFQLRMRVPEGPGAHEEVLPGDVRQALVPPP
PPGTPYELSLHGVPPGGKPSDPIIYQGIMDKDEEKPGKSSGPPRLGELTVTDRTSDSLLL
RWTVPEGEFDSFVIQYKDRDGQPQVVPVEGPQRSAVITSLDPGRKYKFVLYGFVGKKRHG
PLVAEAKILPQSDPSPGTPPHLGNLWVTDPTPDSLHLSWTVPEGQFDTFMVQYRDRDGRP
QVVPVEGPERSFVVSSLDPDHKYRFTLFGIANKKRYGPLTADGTTAPERKEEPPRPEFLE
QPLLGELTVTGVTPDSLRLSWTVAQGPFDSFMVQYKDAQGQPQAVPVAGDENEVTVPGLD
PDRKYKMNLYGLRGRQRVGPESVVAKTAPQEDVDETPSPTELGTEAPESPEEPLLGELTV
TGSSPDSLSLFWTVPQGSFDSFTVQYKDRDGRPRAVRVGGKESEVTVGGLEPGHKYKMHL
YGLHEGQRVGPVSAVGVTAPQQEETPPATESPLEPRLGELTVTDVTPNSVGLSWTVPEGQ
FDSFIVQYKDKDGQPQVVPVAADQREVTVYNLEPERKYKMNMYGLHDGQRMGPLSVVIVT
APLPPAPATEASKPPLEPRLGELTVTDITPDSVGLSWTVPEGEFDSFVVQYKDRDGQPQV
VPVAADQREVTIPDLEPSRKYKFLLFGIQDGKRRSPVSVEAKTVARGDASPGAPPRLGEL
WVTDPTPDSLRLSWTVPEGQFDSFVVQFKDKDGPQVVPVEGHERSVTVTPLDAGRKYRFL
LYGLLGKKRHGPLTADGTTEARSAMDDTGTKRPPKPRLGEELQVTTVTQNSVGLSWTVPE
GQFDSFVVQYKDRDGQPQVVPVEGSLREVSVPGLDPAHRYKLLLYGLHHGKRVGPISAVA
ITAGREETETETTAPTPPAPEPHLGELTVEEATSHTLHLSWMVTEGEFDSFEIQYTDRDG
QLQMVRIGGDRNDITLSGLESDHRYLVTLYGFSDGKHVGPVHVEALTVPEEEKPSEPPTA
TPEPPIKPRLGELTVTDATPDSLSLSWTVPEGQFDHFLVQYRNGDGQPKAVRVPGHEEGV
TISGLEPDHKYKMNLYGFHGGQRMGPVSVVGVTAAEEETPSPTEPSMEAPEPAEEPLLGE
LTVTGSSPDSLSLSWTVPQGRFDSFTVQYKDRDGRPQVVRVGGEESEVTVGGLEPGRKYK
MHLYGLHEGRRVGPVSAVGVTAPEEESPDAPLAKLRLGQMTVRDITSDSLSLSWTVPEGQ
FDHFLVQFKNGDGQPKAVRVPGHEDGVTISGLEPDHKYKMNLYGFHGGQRVGPVSAVGLT
APGKDEEMAPASTEPPTPEPPIKPRLEELTVTDATPDSLSLSWTVPEGQFDHFLVQYKNG
DGQPKATRVPGHEDRVTISGLEPDNKYKMNLYGFHGGQRVGPVSAIGVTAAEEETPSPTE
PSMEAPEPPEEPLLGELTVTGSSPDSLSLSWTVPQGRFDSFTVQYKDRDGRPQVVRVGGE
ESEVTVGGLEPGRKYKMHLYGLHEGRRVGPVSTVGVTAPQEDVDETPSPTEPGTEAPGPP
EEPLLGELTVTGSSPDSLSLSWTVPQGRFDSFTVQYKDRDGRPQAVRVGGQESKVTVRGL
EPGRKYKMHLYGLHEGRRLGPVSAVGVTEDEAETTQAVPTMTPEPPIKPRLGELTMTDAT
PDSLSLSWTVPEGQFDHFLVQYRNGDGQPKAVRVPGHEDGVTISGLEPDHKYKMNLYGFH
GGQRVGPISVIGVTAAEEETPSPTELSTEAPEPPEEPLLGELTVTGSSPDSLSLSWTIPQ
GHFDSFTVQYKDRDGRPQVMRVRGEESEVTVGGLEPGRKYKMHLYGLHEGRRVGPVSTVG
VTEDEAETTQAVPTTTPEPPNKPRLGELTVTDATPDSLSLSWMVPEGQFDHFLVQYRNGD
GQPKVVRVPGHEDGVTISGLEPDHKYKMNLYGFHGGQRVGPISVIGVTAAEEETPAPTEP
STEAPEPPEEPLLGELTVTGSSPDSLSLSWTIPQGRFDSFTVQYKDRDGRPQVVRVRGEE
SEVTVGGLEPGCKYKMHLYGLHEGQRVGPVSAVGVTAPKDEAETTQAVPTMTPEPPIKPR
LGELTVTDATPDSLSLSWMVPEGQFDHFLVQYRNGDGQPKAVRVPGHEDGVTISGLEPDH
KYKMNLYGFHGGQRVGPVSAIGVTEEETPSPTEPSTEAPEAPEEPLLGELTVTGSSPDSL
SLSWTVPQGRFDSFTVQYKDRDGQPQVVRVRGEESEVTVGGLEPGRKYKMHLYGLHEGQR
VGPVSTVGITAPLPTPLPVEPRLGELAVAAVTSDSVGLSWTVAQGPFDSFLVQYRDAQGQ
PQAVPVSGDLRAVAVSGLDPARKYKFLLFGLQNGKRHGPVPVEARTAPDTKPSPRLGELT
VTDATPDSVGLSWTVPEGEFDSFVVQYKDKDGRLQVVPVAANQREVTVQGLEPSRKYRFL
LYGLSGRKRLGPISADSTTAPLEKELPPHLGELTVAEETSSSLRLSWTVAQGPFDSFVVQ
YRDTDGQPRAVPVAADQRTVTVEDLEPGKKYKFLLYGLLGGKRLGPVSALGMTAPEEDTP
APELAPEAPEPPEEPRLGVLTVTDTTPDSMRLSWSVAQGPFDSFVVQYEDTNGQPQALLV
DGDQSKILISGLEPSTPYRFLLYGLHEGKRLGPLSAEGTTGLAPAGQTSEESRPRLSQLS
VTDVTTSSLRLNWEAPPGAFDSFLLRFGVPSPSTLEPHPRPLLQRELMVPGTRHSAVLRD
LRSGTLYSLTLYGLRGPHKADSIQGTARTLSPVLESPRDLQFSEIRETSAKVNWMPPPSR
ADSFKVSYQLADGGEPQSVQVDGQARTQKLQGLIPGARYEVTVVSVRGFEESEPLTGFLT
TVPDGPTQLRALNLTEGFAVLHWKPPQNPVDTYDVQVTAPGAPPLQAETPGSAVDYPLHD
LVLHTNYTATVRGLRGPNLTSPASITFTTGLEAPRDLEAKEVTPRTALLTWTEPPVRPAG
YLLSFHTPGGQNQEILLPGGITSHQLLGLFPSTSYNARLQAMWGQSLLPPVSTSFTTGGL
RIPFPRDCGEEMQNGAGASRTSTIFLNGNRERPLNVFCDMETDGGGWLVFQRRMDGQTDF
WRDWEDYAHGFGNISGEFWLGNEALHSLTQAGDYSMRVDLRAGDEAVFAQYDSFHVDSAA
EYYRLHLEGYHGTAGDSMSYHSGSVFSARDRDPNSLLISCAVSYRGAWWYRNCHYANLNG
LYGSTVDHQGVSWYHWKGFEFSVPFTEMKLRPRNFRSPAGGG
Download sequence
Identical sequences P22105
gi|188528648|ref|NP_061978.6| ENSP00000364396 9606.ENSP00000364396 NP_061978.6.87134 NP_061978.6.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]