SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|188528675|ref|NP_003052.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|188528675|ref|NP_003052.2|
Domain Number 1 Region: 34-217,298-457
Classification Level Classification E-value
Superfamily L domain-like 3.74e-62
Family Ngr ectodomain-like 0.00066
Further Details:      
 
Domain Number 2 Region: 513-671,751-882
Classification Level Classification E-value
Superfamily L domain-like 1.43e-56
Family Ngr ectodomain-like 0.00024
Further Details:      
 
Domain Number 3 Region: 1150-1339
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.24e-44
Family Laminin G-like module 0.0029
Further Details:      
 
Domain Number 4 Region: 1005-1048
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000035
Family EGF-type module 0.007
Further Details:      
 
Domain Number 5 Region: 923-963
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000816
Family EGF-type module 0.0062
Further Details:      
 
Domain Number 6 Region: 1046-1164
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000173
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 7 Region: 965-1009
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000133
Family EGF-type module 0.011
Further Details:      
 
Domain Number 8 Region: 1337-1375
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000289
Family EGF-type module 0.031
Further Details:      
 
Weak hits

Sequence:  gi|188528675|ref|NP_003052.2|
Domain Number - Region: 1379-1414
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000228
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 1424-1455
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000376
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|188528675|ref|NP_003052.2|
Sequence length 1534
Comment slit homolog 1 protein precursor [Homo sapiens]
Sequence
MALTPGWGSSAGPVRPELWLLLWAAAWRLGASACPALCTCTGTTVDCHGTGLQAIPKNIP
RNTERLELNGNNITRIHKNDFAGLKQLRVLQLMENQIGAVERGAFDDMKELERLRLNRNQ
LHMLPELLFQNNQALSRLDLSENAIQAIPRKAFRGATDLKNLQLDKNQISCIEEGAFRAL
RGLEVLTLNNNNITTIPVSSFNHMPKLRTFRLHSNHLFCDCHLAWLSQWLRQRPTIGLFT
QCSGPASLRGLNVAEVQKSEFSCSGQGEAGRVPTCTLSSGSCPAMCTCSNGIVDCRGKGL
TAIPANLPETMTEIRLELNGIKSIPPGAFSPYRKLRRIDLSNNQIAEIAPDAFQGLRSLN
SLVLYGNKITDLPRGVFGGLYTLQLLLLNANKINCIRPDAFQDLQNLSLLSLYDNKIQSL
AKGTFTSLRAIQTLHLAQNPFICDCNLKWLADFLRTNPIETSGARCASPRRLANKRIGQI
KSKKFRCSAKEQYFIPGTEDYQLNSECNSDVVCPHKCRCEANVVECSSLKLTKIPERIPQ
STAELRLNNNEISILEATGMFKKLTHLKKINLSNNKVSEIEDGAFEGAASVSELHLTANQ
LESIRSGMFRGLDGLRTLMLRNNRISCIHNDSFTGLRNVRLLSLYDNQITTVSPGAFDTL
QSLSTLNLLANPFNCNCQLAWLGGWLRKRKIVTGNPRCQNPDFLRQIPLQDVAFPDFRCE
EGQEEGGCLPRPQCPQECACLDTVVRCSNKHLRALPKGIPKNVTELYLDGNQFTLVPGQL
STFKYLQLVDLSNNKISSLSNSSFTNMSQLTTLILSYNALQCIPPLAFQGLRSLRLLSLH
GNDISTLQEGIFADVTSLSHLAIGANPLYCDCHLRWLSSWVKTGYKEPGIARCAGPQDME
GKLLLTTPAKKFECQGPPTLAVQAKCDLCLSSPCQNQGTCHNDPLEVYRCACPSGYKGRD
CEVSLDSCSSGPCENGGTCHAQEGEDAPFTCSCPTGFEGPTCGVNTDDCVDHACANGGVC
VDGVGNYTCQCPLQYEGKACEQLVDLCSPDLNPCQHEAQCVGTPDGPRCECMPGYAGDNC
SENQDDCRDHRCQNGAQCMDEVNSYSCLCAEGYSGQLCEIPPHLPAPKSPCEGTECQNGA
NCVDQGNRPVCQCLPGFGGPECEKLLSVNFVDRDTYLQFTDLQNWPRANITLQVSTAEDN
GILLYNGDNDHIAVELYQGHVRVSYDPGSYPSSAIYSAETINDGQFHTVELVAFDQMVNL
SIDGGSPMTMDNFGKHYTLNSEAPLYVGGMPVDVNSAAFRLWQILNGTGFHGCIRNLYIN
NELQDFTKTQMKPGVVPGCEPCRKLYCLHGICQPNATPGPMCHCEAGWVGLHCDQPADGP
CHGHKCVHGQCVPLDALSYSCQCQDGYSGALCNQAGALAEPCRGLQCLHGHCQASGTKGA
HCVCDPGFSGELCEQESECRGDPVRDFHQVQRGYAICQTTRPLSWVECRGSCPGQGCCQG
LRLKRRKFTFECSDGTSFAEEVEKPTKCGCALCA
Download sequence
Identical sequences O75093
ENSP00000266058 9606.ENSP00000266058 gi|188528675|ref|NP_003052.2| NP_003052.2.87134 NP_003052.2.92137 ENSP00000266058 ENSP00000266058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]