SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|188595677|ref|NP_001120963.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|188595677|ref|NP_001120963.1|
Domain Number 1 Region: 122-365
Classification Level Classification E-value
Superfamily vWA-like 1.11e-84
Family Integrin A (or I) domain 0.000000401
Further Details:      
 
Domain Number 2 Region: 621-697
Classification Level Classification E-value
Superfamily Integrin beta tail domain 6.93e-18
Family Integrin beta tail domain 0.0027
Further Details:      
 
Domain Number 3 Region: 338-452
Classification Level Classification E-value
Superfamily Integrin domains 5.75e-17
Family Integrin domains 0.0015
Further Details:      
 
Domain Number 4 Region: 22-81
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000502
Family Plexin repeat 0.0019
Further Details:      
 
Domain Number 5 Region: 535-575
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000174
Family Integrin beta EGF-like domains 0.00032
Further Details:      
 
Domain Number 6 Region: 579-619
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000279
Family Integrin beta EGF-like domains 0.0092
Further Details:      
 
Weak hits

Sequence:  gi|188595677|ref|NP_001120963.1|
Domain Number - Region: 457-484
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00279
Family Integrin beta EGF-like domains 0.038
Further Details:      
 
Domain Number - Region: 500-528
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00419
Family Integrin beta EGF-like domains 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|188595677|ref|NP_001120963.1|
Sequence length 769
Comment integrin beta-2 precursor [Homo sapiens]
Sequence
MLGLRPPLLALVGLLSLGCVLSQECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSI
RCDTRPQLLMRGCAADDIMDPTSLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFR
RAKGYPIDLYYLMDLSYSMLDDLRNVKKLGGDLLRALNEITESGRIGFGSFVDKTVLPFV
NTHPDKLRNPCPNKEKECQPPFAFRHVLKLTNNSNQFQTEVGKQLISGNLDAPEGGLDAM
MQVAACPEEIGWRNVTRLLVFATDDGFHFAGDGKLGAILTPNDGRCHLEDNLYKRSNEFD
YPSVGQLAHKLAENNIQPIFAVTSRMVKTYEKLTEIIPKSAVGELSEDSSNVVQLIKNAY
NKLSSRVFLDHNALPDTLKVTYDSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATEC
IQEQSFVIRALGFTDIVTVQVLPQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKN
CECQTQGRSSQELEGSCRKDNNSIICSGLGDCVCGQCLCHTSDVPGKLIYGQYCECDTIN
CERYNGQVCGGPGRGLCFCGKCRCHPGFEGSACQCERTTEGCLNPRRVECSGRGRCRCNV
CECHSGYQLPLCQECPGCPSPCGKYISCAECLKFEKGPFGKNCSAACPGLQLSNNPVKGR
TCKERDSEGCWVAYTLEQQDGMDRYLIYVDESRECVAGPNIAAIVGGTVAGIVLIGILLL
VIWKALIHLSDLREYRRFEKEKLKSQWNNDNPLFKSATTTVMNPKFAES
Download sequence
Identical sequences P05107
ENSP00000303242 gi|188595677|ref|NP_001120963.1| gi|89191865|ref|NP_000202.2| 9606.ENSP00000303242 ENSP00000303242 ENSP00000347279 ENSP00000380948 ENSP00000380950 ENSP00000380955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]