SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|189217425|ref|NP_001121189.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|189217425|ref|NP_001121189.1|
Domain Number 1 Region: 3101-3276
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-31
Family Laminin G-like module 0.0011
Further Details:      
 
Domain Number 2 Region: 2931-3094
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.91e-28
Family Laminin G-like module 0.0015
Further Details:      
 
Domain Number 3 Region: 2532-2704
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.05e-20
Family Laminin G-like module 0.0038
Further Details:      
 
Domain Number 4 Region: 2703-2872
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.8e-19
Family Laminin G-like module 0.012
Further Details:      
 
Domain Number 5 Region: 2331-2522
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000739
Family Laminin G-like module 0.021
Further Details:      
 
Domain Number 6 Region: 1356-1407
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000001
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 7 Region: 1687-1729
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000023
Family Laminin-type module 0.0065
Further Details:      
 
Domain Number 8 Region: 1739-1789
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000251
Family Laminin-type module 0.048
Further Details:      
 
Domain Number 9 Region: 356-428
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000335
Family Laminin-type module 0.022
Further Details:      
 
Domain Number 10 Region: 536-581
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000335
Family Laminin-type module 0.008
Further Details:      
 
Domain Number 11 Region: 1266-1314
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000474
Family Laminin-type module 0.0086
Further Details:      
 
Domain Number 12 Region: 299-358
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000067
Family Laminin-type module 0.061
Further Details:      
 
Domain Number 13 Region: 491-538
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000949
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 14 Region: 631-681
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000558
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 15 Region: 1405-1453
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000753
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 16 Region: 426-469
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000109
Family Laminin-type module 0.024
Further Details:      
 
Domain Number 17 Region: 684-725
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000921
Family Laminin-type module 0.021
Further Details:      
 
Weak hits

Sequence:  gi|189217425|ref|NP_001121189.1|
Domain Number - Region: 586-628
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000128
Family Laminin-type module 0.016
Further Details:      
 
Domain Number - Region: 1860-2103
Classification Level Classification E-value
Superfamily Tropomyosin 0.000281
Family Tropomyosin 0.008
Further Details:      
 
Domain Number - Region: 104-184
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00189
Family APC10-like 0.06
Further Details:      
 
Domain Number - Region: 1652-1689
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00307
Family Laminin-type module 0.051
Further Details:      
 
Domain Number - Region: 1318-1353
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00335
Family Laminin-type module 0.032
Further Details:      
 
Domain Number - Region: 2044-2267
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0183
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|189217425|ref|NP_001121189.1|
Sequence length 3277
Comment laminin subunit alpha-3 isoform 3 [Homo sapiens]
Sequence
MAAAARPRGRALGPVLPPTPLLLLVLRVLPACGATARDPGAAAGLSLHPTYFNLAEAARI
WATATCGERGPGEGRPQPELYCKLVGGPTAPGSGHTIQGQFCDYCNSEDPRKAHPVTNAI
DGSERWWQSPPLSSGTQYNRVNLTLDLGQLFHVAYILIKFANSPRPDLWVLERSVDFGST
YSPWQYFAHSKVDCLKEFGREANMAVTRDDDVLCVTEYSRIVPLENGEVVVSLINGRPGA
KNFTFSHTLREFTKATNIRLRFLRTNTLLGHLISKAQRDPTVTRRYYYSIKDISIGGQCV
CNGHAEVCNINNPEKLFRCECQHHTCGETCDRCCTGYNQRRWRPAAWEQSHECEACNCHG
HASNCYYDPDVERQQASLNTQGIYAGGGVCINCQHNTAGVNCEQCAKGYYRPYGVPVDAP
DGCIPCSCDPEHADGCEQGSGRCHCKPNFHGDNCEKCAIGYYNFPFCLRIPIFPVSTPSS
EDPVAGDIKGCDCNLEGVLPEICDAHGRCLCRPGVEGPRCDTCRSGFYSFPICQACWCSA
LGSYQMPCSSVTGQCECRPGVTGQRCDRCLSGAYDFPHCQGSSSACDPAGTINSNLGYCQ
CKLHVEGPTCSRCKLLYWNLDKENPSGCSECKCHKAGTVSGTGECRQGDGDCHCKSHVGG
DSCDTCEDGYFALEKSNYFGCQGCQCDIGGALSSMCSGPSGVCQCREHVVGKVCQRPENN
YYFPDLHHMKYEIEDGSTPNGRDLRFGFDPLAFPEFSWRGYAQMTSVQNDVRITLNVGKS
SGSLFRVILRYVNPGTEAVSGHITIYPSWGAAQSKEIIFLPSKEPAFVTVPGNGFADPFS
ITPGIWVACIKAEGVLLDYLVLLPRDYYEASVLQLPVTEPCAYAGPPQENCLLYQHLPVT
RFPCTLACEARHFLLDGEPRPVAVRQPTPAHPVMVDLSGREVELHLRLRIPQVGHYVVVV
EYSTEAAQLFVVDVNVKSSGSVLAGQVNIYSCNYSVLCRSAVIDHMSRIAMYELLADADI
QLKGHMARFLLHQVCIIPIEEFSAEYVRPQVHCIASYGRFVNQSATCVSLAHETPPTALI
LDVLSGRPFPHLPQQSSPSVDVLPGVTLKAPQNQVTLRGRVPHLGRYVFVIHFYQAAHPT
FPAQVSVDGGWPRAGSFHASFCPHVLGCRDQVIAEGQIEFDISEPEVAATVKVPEGKSLV
LVRVLVVPAENYDYQILHKKSMDKSLEFITNCGKNSFYLDPQTASRFCKNSARSLVAFYH
KGALPCECHPTGATGPHCSPEGGQCPCQPNVIGRQCTRCATGHYGFPRCKPCSCGRRLCE
EMTGQCRCPPRTVRPQCEVCETHSFSFHPMAGCEGCNCSRRGTIEAAMPECDRDSGQCRC
KPRITGRQCDRCASGFYRFPECVPCNCNRDGTEPGVCDPGTGACLCKENVEGTECNVCRE
GSFHLDPANLKGCTSCFCFGVNNQCHSSHKRRTKFVDMLGWHLETADRVDIPVSFNPGSN
SMVADLQELPATIHSASWVAPTSYLGDKVSSYGGYLTYQAKSFGLPGDMVLLEKKPDVQL
TGQHMSIIYEETNTPRPDRLHHGRVHVVEGNFRHASSRAPVSREELMTVLSRLADVRIQG
LYFTETQRLTLSEVGLEEASDTGSGRIALAVEICACPPAYAGDSCQGCSPGYYRDHKGLY
TGRCVPCNCNGHSNQCQDGSGICVNCQHNTAGEHCERCQEGYYGNAVHGSCRACPCPHTN
SFATGCVVNGGDVRCSCKAGYTGTQCERCAPGYFGNPQKFGGSCQPCSCNSNGQLGSCHP
LTGDCINQEPKDSSPAEECDDCDSCVMTLLNDLATMGEQLRLVKSQLQGLSASAGLLEQM
RHMETQAKDLRNQLLNYRSAISNHGSKIEGLERELTDLNQEFETLQEKAQVNSRKAQTLN
NNVNRATQSAKELDVKIKNVIRNVHMLNRIRTWQKTHQGENNGLANSIRDSLNEYEAKLS
DLRARLQEAAAQAKQANGLNQENERALGAIQRQVKEINSLQSDFTKYLTTADSSLLQTNI
ALQLMEKSQKEYEKLAASLNEARQELSDKVRELSRSAGKTSLVEEAEKHARSLQELAKQL
EEIKRNASGDELVRCAVDAATAYENILNAIKAAEDAANRAASASESALQTVIKEDLPRKA
KTLSSNSDKLLNEAKMTQKKLKQEVSPALNNLQQTLNIVTVQKEVIDTNLTTLRDGLHGI
QRGDIDAMISSAKSMVRKANDITDEVLDGLNPIQTDVERIKDTYGRTQNEDFKKALTDAD
NSVNKLTNKLPDLWRKIESINQQLLPLGNISDNMDRIRELIQQARDAASKVAVPMRFNGK
SGVEVRLPNDLEDLKGYTSLSLFLQRPNSRENGGTENMFVMYLGNKDASRDYIGMAVVDG
QLTCVYNLGDREAELQVDQILTKSETKEAVMDRVKFQRIYQFARLNYTKGATSSKPETPG
VYDMDGRNSNTLLNLDPENVVFYVGGYPPDFKLPSRLSFPPYKGCIELDDLNENVLSLYN
FKKTFNLNTTEVEPCRRRKEESDKNYFEGTGYARVPTQPHAPIPTFGQTIQTTVDRGLLF
FAENGDRFISLNIEDGKLMVRYKLNSELPKERGVGDAINNGRDHSIQIKIGKLQKRMWIN
VDVQNTIIDGEVFDFSTYYLGGIPIAIRERFNISTPAFRGCMKNLKKTSGVVRLNDTVGV
TKKCSEDWKLVRSASFSRGGQLSFTDLGLPPTDHLQASFGFQTFQPSGILLDHQTWTRNL
QVTLEDGYIELSTSDSGSPIFKSPQTYMDGLLHYVSVISDNSGLRLLIDDQLLRNSKRLK
HISSSRQSLRLGGSNFEGCISNVFVQRLSLSPEVLDLTSNSLKRDVSLGGCSLNKPPFLM
LLKGSTRFNKTKTFRINQLLQDTPVASPRSVKVWQDACSPLPKTQANHGALQFGDIPTSH
LLFKLPQELLKPRSQFAVDMQTTSSRGLVFHTGTKNSFMALYLSKGRLVFALGTDGKKLR
IKSKEKCNDGKWHTVVFGHDGEKGRLVVDGLRAREGSLPGNSTISIRAPVYLGSPPSGKP
KSLPTNSFVGCLKNFQLDSKPLYTPSSSFGVSSCLGGPLEKGIYFSEEGGHVVLAHSVLL
GPEFKLVFSIRPRSLTGILIHIGSQPGKHLCVYLEAGKVTASMDSGAGGTSTSVTPKQSL
CDGQWHSVAVTIKQHILHLELDTDSSYTAGQIPFPPASTQEPLHLGGAPANLTTLRIPVW
KSFFGCLRNIHVNHIPVPVTEALEVQGPVSLNGCPDQ
Download sequence
Identical sequences gi|189217425|ref|NP_001121189.1| ENSP00000382432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]