SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|189491645|ref|NP_694946.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|189491645|ref|NP_694946.2|
Domain Number 1 Region: 79-147
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.31e-16
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 2 Region: 137-176
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000001
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 3 Region: 221-281
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000236
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  gi|189491645|ref|NP_694946.2|
Domain Number - Region: 195-232
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00152
Family EGF-type module 0.03
Further Details:      
 
Domain Number - Region: 273-304
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00367
Family EGF-type module 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|189491645|ref|NP_694946.2|
Sequence length 439
Comment fibulin-7 isoform 1 [Homo sapiens]
Sequence
MVPSSPRALFLLLLILACPEPRASQNCLSKQQLLSAIRQLQQLLKGQETRFAEGIRHMKS
RLAALQNSVGRVGPDALPVSCPALNTPADGRKFGSKYLVDHEVHFTCNPGFRLVGPSSVV
CLPNGTWTGEQPHCRGISECSSQPCQNGGTCVEGVNQYRCICPPGRTGNRCQHQAQTAAP
EGSVAGDSAFSRAPRCAQVERAQHCSCEAGFHLSGAAGDSVCQDVNECELYGQEGRPRLC
MHACVNTPGSYRCTCPGGYRTLADGKSCEDVDECVGLQPVCPQGTTCINTGGSFQCVSPE
CPEGSGNVSYVKTSPFQCERNPCPMDSRPCRHLPKTISFHYLSLPSNLKTPITLFRMATA
SAPGRAGPNSLRFGIVGGNSRGHFVMQRSDRQTGDLILVQNLEGPQTLEVDVDMSEYLDR
SFQANHVSKVTIFVSPYDF
Download sequence
Identical sequences Q53RD9
ENSP00000331411 9606.ENSP00000331411 ENSP00000272559 NP_694946.2.87134 NP_694946.2.92137 gi|189491645|ref|NP_694946.2| ENSP00000331411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]