SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|189571669|ref|NP_861449.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|189571669|ref|NP_861449.2|
Domain Number 1 Region: 12-124
Classification Level Classification E-value
Superfamily PH domain-like 1.6e-37
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000119
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|189571669|ref|NP_861449.2|
Sequence length 418
Comment sprouty-related, EVH1 domain-containing protein 2 isoform a [Homo sapiens]
Sequence
MTEETHPDDDSYIVRVKAVVMTRDDSSGGWFPQEGGGISRVGVCKVMHPEGNGRSGFLIH
GERQKDKLVVLECYVRKDLVYTKANPTFHHWKVDNRKFGLTFQSPADARAFDRGVRKAIE
DLIEGSTTSSSTIHNEAELGDDDVFTTATDSSSNSSQKREQPTRTISSPTSCEHRRIYTL
GHLHDSYPTDHYHLDQPMPRPYRQVSFPDDDEEIVRINPREKIWMTGYEDYRHAPVRGKY
PDPSEDADSSYVRFAKGEVPKHDYNYPYVDSSDFGLGEDPKGRGGSVIKTQPSRGKSRRR
KEDGERSRCVYCRDMFNHEENRRGHCQDAPDSVRTCIRRVSCMWCADSMLYHCMSDPEGD
YTDPCSCDTSDEKFCLRWMALIALSFLAPCMCCYLPLRACYHCGVMCRCCGGKHKAAA
Download sequence
Identical sequences A0A2I2Z4Q7 A0A2I3H9J8 A0A2I3NEP4 A0A2K5M6I0 A0A2K5UUA4 A0A2K6B843 F6WRR5 K7B5Y6 Q7Z698
ENSPANP00000018752 ENSNLEP00000012132 NP_001248029.1.72884 NP_861449.2.87134 NP_861449.2.92137 XP_003830955.1.60992 XP_005575784.1.63531 XP_007968619.1.81039 XP_011711738.1.29376 XP_011895013.1.92194 XP_012356692.1.23891 XP_016804136.1.37143 XP_018876891.1.27298 gi|189571669|ref|NP_861449.2| ENSP00000348753 9544.ENSMMUP00000007900 9606.ENSP00000348753 ENSP00000348753 ENSNLEP00000012132 ENSMMUP00000007900 ENSMMUP00000007900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]