SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|189571671|ref|NP_001121682.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|189571671|ref|NP_001121682.1|
Domain Number 1 Region: 9-121
Classification Level Classification E-value
Superfamily PH domain-like 1.6e-37
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000128
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|189571671|ref|NP_001121682.1|
Sequence length 415
Comment sprouty-related, EVH1 domain-containing protein 2 isoform b [Homo sapiens]
Sequence
MASPGSDSYIVRVKAVVMTRDDSSGGWFPQEGGGISRVGVCKVMHPEGNGRSGFLIHGER
QKDKLVVLECYVRKDLVYTKANPTFHHWKVDNRKFGLTFQSPADARAFDRGVRKAIEDLI
EGSTTSSSTIHNEAELGDDDVFTTATDSSSNSSQKREQPTRTISSPTSCEHRRIYTLGHL
HDSYPTDHYHLDQPMPRPYRQVSFPDDDEEIVRINPREKIWMTGYEDYRHAPVRGKYPDP
SEDADSSYVRFAKGEVPKHDYNYPYVDSSDFGLGEDPKGRGGSVIKTQPSRGKSRRRKED
GERSRCVYCRDMFNHEENRRGHCQDAPDSVRTCIRRVSCMWCADSMLYHCMSDPEGDYTD
PCSCDTSDEKFCLRWMALIALSFLAPCMCCYLPLRACYHCGVMCRCCGGKHKAAA
Download sequence
Identical sequences A0A096P077 A0A0D9RQL5 A0A1D5QDM1 A0A2K5M6K4 A0A2K5UU79 A0A2K5ZMK6 A0A2K6B863 G1RFY2 G3QWF4 K7CJL3
ENSP00000393697 NP_001121682.1.87134 NP_001121682.1.92137 XP_003262510.1.23891 XP_003830956.1.60992 XP_004029377.2.27298 XP_005575785.1.63531 XP_007968620.1.81039 XP_011711739.1.29376 XP_011840901.1.47321 XP_011895014.1.92194 XP_014967994.1.72884 XP_016804137.1.37143 gi|189571671|ref|NP_001121682.1| ENSP00000393697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]