SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|190194423|ref|NP_001121782.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|190194423|ref|NP_001121782.1|
Domain Number 1 Region: 513-663
Classification Level Classification E-value
Superfamily EF-hand 1.75e-50
Family Osteonectin 0.00000203
Further Details:      
 
Domain Number 2 Region: 458-510
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000347
Family Ovomucoid domain III-like 0.00054
Further Details:      
 
Domain Number 3 Region: 431-455
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000414
Family Follistatin (FS) module N-terminal domain, FS-N 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|190194423|ref|NP_001121782.1|
Sequence length 664
Comment SPARC-like protein 1 precursor [Homo sapiens]
Sequence
MKTGLFFLCLLGTAAAIPTNARLLSDHSKPTAETVAPDNTAIPSLRAEAEENEKETAVST
EDDSHHKAEKSSVLKSKEESHEQSAEQGKSSSQELGLKDQEDSDGHLSVNLEYAPTEGTL
DIKEDMSEPQEKKLSENTDFLAPGVSSFTDSNQQESITKREENQEQPRNYSHHQLNRSSK
HSQGLRDQGNQEQDPNISNGEEEEEKEPGEVGTHNDNQERKTELPREHANSKQEEDNTQS
DDILEESDQPTQVSKMQEDEFDQGNQEQEDNSNAEMEEENASNVNKHIQETEWQSQEGKT
GLEAISNHKETEEKTVSEALLMEPTDDGNTTPRNHGVDDDGDDDGDDGGTDGPRHSASDD
YFIPSQAFLEAERAQSIAYHLKIEEQREKVHENENIGTTEPGEHQEAKKAENSSNEEETS
SEGNMRVHAVDSCMSFQCKRGHICKADQQGKPHCVCQDPVTCPPTKPLDQVCGTDNQTYA
SSCHLFATKCRLEGTKKGHQLQLDYFGACKSIPTCTDFEVIQFPLRMRDWLKNILMQLYE
ANSEHAGYLNEKQRNKVKKIYLDEKRLLAGDHPIDLLLRDFKKNYHMYVYPVHWQFSELD
QHPMDRVLTHSELAPLRASLVPMEHCITRFFEECDPNKDKHITLKEWGHCFGIKEEDIDE
NLLF
Download sequence
Identical sequences A0A024RDE1 Q14515
9606.ENSP00000282470 ENSP00000282470 ENSP00000414856 gi|190194423|ref|NP_001121782.1| gi|190341024|ref|NP_004675.3| ENSP00000282470 NP_001121782.1.87134 NP_001121782.1.92137 NP_004675.3.87134 NP_004675.3.92137 ENSP00000282470 ENSP00000414856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]