SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|190358520|ref|NP_064501.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|190358520|ref|NP_064501.2|
Domain Number 1 Region: 335-431
Classification Level Classification E-value
Superfamily Immunoglobulin 8.81e-20
Family I set domains 0.01
Further Details:      
 
Domain Number 2 Region: 494-785
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.00000000000000628
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.042
Further Details:      
 
Domain Number 3 Region: 81-133
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000236
Family Ovomucoid domain III-like 0.0094
Further Details:      
 
Domain Number 4 Region: 256-347
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000018
Family V set domains (antibody variable domain-like) 0.09
Further Details:      
 
Domain Number 5 Region: 179-247
Classification Level Classification E-value
Superfamily EF-hand 0.00000000106
Family Parvalbumin 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|190358520|ref|NP_064501.2|
Sequence length 847
Comment follistatin-related protein 5 isoform a [Homo sapiens]
Sequence
MFKCWSVVLVLGFIFLESEGRPTKEGGYGLKSYQPLMRLRHKQEKNQESSRVKGFMIQDG
PFGSCENKYCGLGRHCVTSRETGQAECACMDLCKRHYKPVCGSDGEFYENHCEVHRAACL
KKQKITIVHNEDCFFKGDKCKTTEYSKMKNMLLDLQNQKYIMQENENPNGDDISRKKLLV
DQMFKYFDADSNGLVDINELTQVIKQEELGKDLFDCTLYVLLKYDDFNADKHLALEEFYR
AFQVIQLSLPEDQKLSITAATVGQSAVLSCAIQGTLRPPIIWKRNNIILNNLDLEDINDF
GDDGSLYITKVTTTHVGNYTCYADGYEQVYQTHIFQVNVPPVIRVYPESQAREPGVTASL
RCHAEGIPKPQLGWLKNGIDITPKLSKQLTLQANGSEVHISNVRYEDTGAYTCIAKNEAG
VDEDISSLFVEDSARKTLANILWREEGLGIGNMFYVFYEDGIKVIQPIECEFQRHIKPSE
KLLGFQDEVCPKAEGDEVQRCVWASAVNVKDKFIYVAQPTLDRVLIVDVQSQKVVQAVST
DPVPVKLHYDKSHDQVWVLSWGTLEKTSPTLQVITLASGNVPHHTIHTQPVGKQFDRVDD
FFIPTTTLIITHMRFGFILHKDEAALQKIDLETMSYIKTINLKDYKCVPQSLAYTHLGGY
YFIGCKPDSTGAVSPQVMVDGVTDSVIGFNSDVTGTPYVSPDGHYLVSINDVKGLVRVQY
ITIRGEIQEAFDIYTNLHISDLAFQPSFTEAHQYNIYGSSSTQTDVLFVELSSGKVKMIK
SLKEPLKAEEWPWNRKNRQIQDSGLFGQYLMTPSKDSLFILDGRLNKLNCEITEVEKGNT
VIWVGDA
Download sequence
Identical sequences Q8N475
gi|190358520|ref|NP_064501.2| ENSP00000305334 ENSP00000305334 ENSP00000305334 NP_064501.2.87134 NP_064501.2.92137 NYSGRC-IgSF-FSTL5_HUMAN 9606.ENSP00000305334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]