SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|190684644|ref|NP_005730.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|190684644|ref|NP_005730.2|
Domain Number 1 Region: 36-463
Classification Level Classification E-value
Superfamily Ras GEF 2.48e-102
Family Ras GEF 0.00041
Further Details:      
 
Domain Number 2 Region: 524-592
Classification Level Classification E-value
Superfamily Cysteine-rich domain 3.29e-20
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0011
Further Details:      
 
Domain Number 3 Region: 371-390,459-529
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000305
Family Calmodulin-like 0.036
Further Details:      
 
Weak hits

Sequence:  gi|190684644|ref|NP_005730.2|
Domain Number - Region: 747-783
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0523
Family Mitotic arrest deficient-like 1, Mad1 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|190684644|ref|NP_005730.2|
Sequence length 797
Comment RAS guanyl-releasing protein 1 isoform a [Homo sapiens]
Sequence
MGTLGKAREAPRKPSHGCRAASKARLEAKPANSPFPSHPSLAHITQFRMMVSLGHLAKGA
SLDDLIDSCIQSFDADGNLCRSNQLLQVMLTMHRIVISSAELLQKVITLYKDALAKNSPG
LCLKICYFVRYWITEFWVMFKMDASLTDTMEEFQELVKAKGEELHCRLIDTTQINARDWS
RKLTQRIKSNTSKKRKVSLLFDHLEPEELSEHLTYLEFKSFRRISFSDYQNYLVNSCVKE
NPTMERSIALCNGISQWVQLMVLSRPTPQLRAEVFIKFIQVAQKLHQLQNFNTLMAVIGG
LCHSSISRLKETSSHVPHEINKVLGEMTELLSSSRNYDNYRRAYGECTDFKIPILGVHLK
DLISLYEAMPDYLEDGKVNVHKLLALYNHISELVQLQEVAPPLEANKDLVHLLTLSLDLY
YTEDEIYELSYAREPRNHRAPPLTPSKPPVVVDWASGVSPKPDPKTISKHVQRMVDSVFK
NYDHDQDGYISQEEFEKIAASFPFSFCVMDKDREGLISRDEITAYFMRASSIYSKLGLGF
PHNFQETTYLKPTFCDNCAGFLWGVIKQGYRCKDCGMNCHKQCKDLVVFECKKRAKNPVA
PTENNTSVGPVSNLCSLGAKDLLHAPEEGPFTFPNGEAVEHGEESKDRTIMLMGVSSQKI
SLRLKRAVAHKATQTESQPWIGSEGPSGPFVLSSPRKTAQDTLYVLPSPTSPCPSPVLVR
KRAFVKWENKDSLIKSKEELRHLRLPTYQELEQEINTLKADNDALKIQLKYAQKKIESLQ
LEKSNHVLAQMEQGDCS
Download sequence
Identical sequences H2Q951 O95267
NP_005730.2.87134 NP_005730.2.92137 XP_510293.2.37143 ENSPTRP00000011792 ENSPTRP00000011792 gi|190684644|ref|NP_005730.2| ENSP00000310244 ENSP00000310244 9606.ENSP00000310244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]