SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|190684646|ref|NP_001122074.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|190684646|ref|NP_001122074.1|
Domain Number 1 Region: 36-448
Classification Level Classification E-value
Superfamily Ras GEF 1.31e-98
Family Ras GEF 0.00042
Further Details:      
 
Domain Number 2 Region: 489-557
Classification Level Classification E-value
Superfamily Cysteine-rich domain 3.49e-20
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0011
Further Details:      
 
Domain Number 3 Region: 434-493
Classification Level Classification E-value
Superfamily EF-hand 0.000000000995
Family Calmodulin-like 0.034
Further Details:      
 
Weak hits

Sequence:  gi|190684646|ref|NP_001122074.1|
Domain Number - Region: 712-748
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0497
Family Mitotic arrest deficient-like 1, Mad1 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|190684646|ref|NP_001122074.1|
Sequence length 762
Comment RAS guanyl-releasing protein 1 isoform b [Homo sapiens]
Sequence
MGTLGKAREAPRKPSHGCRAASKARLEAKPANSPFPSHPSLAHITQFRMMVSLGHLAKGA
SLDDLIDSCIQSFDADGNLCRSNQLLQVMLTMHRIVISSAELLQKVITLYKDALAKNSPG
LCLKICYFVRYWITEFWVMFKMDASLTDTMEEFQELVKAKGEELHCRLIDTTQINARDWS
RKLTQRIKSNTSKKRKVSLLFDHLEPEELSEHLTYLEFKSFRRISFSDYQNYLVNSCVKE
NPTMERSIALCNGISQWVQLMVLSRPTPQLRAEVFIKFIQVAQKLHQLQNFNTLMAVIGG
LCHSSISRLKETSSHVPHEINKVLGEMTELLSSSRNYDNYRRAYGECTDFKIPILGVHLK
DLISLYEAMPDYLEDGKVNVHKLLALYNHISELVQLQEVAPPLEANKDLVHLLTLSLDLY
YTEDEIYELSYAREPRNHRAPSVFKNYDHDQDGYISQEEFEKIAASFPFSFCVMDKDREG
LISRDEITAYFMRASSIYSKLGLGFPHNFQETTYLKPTFCDNCAGFLWGVIKQGYRCKDC
GMNCHKQCKDLVVFECKKRAKNPVAPTENNTSVGPVSNLCSLGAKDLLHAPEEGPFTFPN
GEAVEHGEESKDRTIMLMGVSSQKISLRLKRAVAHKATQTESQPWIGSEGPSGPFVLSSP
RKTAQDTLYVLPSPTSPCPSPVLVRKRAFVKWENKDSLIKSKEELRHLRLPTYQELEQEI
NTLKADNDALKIQLKYAQKKIESLQLEKSNHVLAQMEQGDCS
Download sequence
Identical sequences A0A2I3RGV4
gi|190684646|ref|NP_001122074.1| ENSP00000388540 NP_001122074.1.87134 NP_001122074.1.92137 XP_016783406.1.37143 ENSP00000388540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]