SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|190885497|ref|NP_001122088.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|190885497|ref|NP_001122088.1|
Domain Number 1 Region: 110-319
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.83e-54
Family DBL homology domain (DH-domain) 0.0000597
Further Details:      
 
Domain Number 2 Region: 330-453
Classification Level Classification E-value
Superfamily PH domain-like 1.59e-19
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|190885497|ref|NP_001122088.1|
Sequence length 532
Comment rho guanine nucleotide exchange factor 3 isoform 2 [Homo sapiens]
Sequence
MIEVCHHNWLLWLCPSKFGIFMCCLASTTGQMELRRTREPSNKRVKPLSRVTSLANLIPP
VKATPLKRFSQTLQRSISFRSESRPDILAPRPWSRNAAPSSTKRRDSKLWSETFDVCVNQ
MLTSKEIKRQEAIFELSQGEEDLIEDLKLAKKAYHDPMLKLSIMTEQELNQIFGTLDSLI
PLHEELLSQLRDVRKPDGSTEHVGPILVGWLPCLSSYDSYCSNQVAAKALLDHKKQDHRV
QDFLQRCLESPFSRKLDLWNFLDIPRSRLVKYPLLLREILRHTPNDNPDQQHLEEAINII
QGIVAEINTKTGESECRYYKERLLYLEEGQKDSLIDSSRVLCCHGELKNNRGVKLHVFLF
QEVLVITRAVTHNEQLCYQLYRQPIPVKDLLLEDLQDGEVRLGGSLRGAFSNNERIKNFF
RVSFKNGSQSQTHSLQANDTFNKQQWLNCIRQAKETVLCAAGQAGVLDSEGSFLNPTTGS
RELQGETKLEQMDQSDSESDCSMDTSEVSLDCERMEQTDSSCGNSRHGESNV
Download sequence
Identical sequences A0A2J8T144 G3QEG3
gi|190885497|ref|NP_001122088.1| ENSP00000410922 NP_001122088.1.87134 NP_001122088.1.92137 XP_004034390.1.27298 ENSP00000410922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]