SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|190886454|ref|NP_848543.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|190886454|ref|NP_848543.2|
Domain Number - Region: 14-96
Classification Level Classification E-value
Superfamily EF-hand 0.0476
Family Calmodulin-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|190886454|ref|NP_848543.2|
Sequence length 394
Comment protein C9orf140 [Homo sapiens]
Sequence
MAGAAMAERGRVPPPAPAPSTEGLPRAFLQSLRTLFDILDDRRRGCVHLREIESRWQGTD
ARELPRGVLEGLRQVAPASGYLTFERFVAGLRTSLLSADGGPRDPTRAPARPGDQPPPPP
QRLVFAPADEPRTVLERKPLPLGVRAPLAGPSAAARSPEQLCAPAEAAPCPAEPERSQSA
ALEPSSSADAGAVACRALEADSGDARRAPRARGERRRHTIASGVDCGLLKQMKELEQEKE
VLLQGLEMMARGRDWYQQQLQRVQERQRRLGQSRASADFGAAGSPRPLGRLLPKVQEVAR
CLGELLAAACASRALPPSSSGPPCPALTSTSPPVWQQQTILMLKEQNRLLTQEVTEKSER
ITQLEQEKSALIKQLFEARALSQQDGGPLDSTFI
Download sequence
Identical sequences Q86UD0
ENSP00000386348 NP_848543.2.87134 NP_848543.2.92137 ENSP00000386348 gi|190886454|ref|NP_848543.2| 9606.ENSP00000386348 ENSP00000386348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]