SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|191252816|ref|NP_001122108.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|191252816|ref|NP_001122108.1|
Domain Number 1 Region: 60-232
Classification Level Classification E-value
Superfamily L domain-like 2.55e-34
Family Ngr ectodomain-like 0.015
Further Details:      
 
Weak hits

Sequence:  gi|191252816|ref|NP_001122108.1|
Domain Number - Region: 320-412
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0041
Family Fibronectin type III 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|191252816|ref|NP_001122108.1|
Sequence length 828
Comment extracellular leucine-rich repeat and fibronectin type-III domain-containing protein 1 [Homo sapiens]
Sequence
MAGRGWGALWVCVAAATLLHAGGLARADCWLIEGDKGFVWLAICSQNQPPYEAIPQQINS
TIVDLRLNENRIRSVQYASLSRFGNLTYLNLTKNEIGYIEDGAFSGQFNLQVLQLGYNRL
RNLTEGMLRGLGKLEYLYLQANLIEVVMASSFWECPNIVNIDLSMNRIQQLNSGTFAGLA
KLSVCELYSNPFYCSCELLGFLRWLAAFTNATQTYDRMQCESPPVYSGYYLLGQGRRGHR
SILSKLQSVCTEDSYAAEVVGPPRPASGRSQPGRSPPPPPPPEPSDMPCADDECFSGDGT
TPLVALPTLATQAEARPLIKVKQLTQNSATITVQLPSPFHRMYTLEHFNNSKASTVSRLT
KAQEEIRLTNLFTLTNYTYCVVSTSAGLRHNHTCLTICLPRLPSPPGPVPSPSTATHYIM
TILGCLFGMVLVLGAVYYCLRRRRRQEEKHKKAASAAAAGSLKKTIIELKYGPELEAPGL
APLSQGPLLGPEAVTRIPYLPAAGEVEQYKLVESADTPKASKGSYMEVRTGDPPERRDCE
LGRPGPDSQSSVAEISTIAKEVDKVNQIINNCIDALKSESTSFQGVKSGPVSVAEPPLVL
LSEPLAAKHGFLAPGYKDAFGHSLQRHHSVEAAGPPRASTSSSGSVRSPRAFRAEAVGVH
KAAAAEAKYIEKGSPAADAILTVTPAAAVLRAEAEKGRQYGEHRHSYPGSHPAEPPAPPG
PPPPPPHEGLGRKASILEPLTRPRPRDLAYSQLSPQYHSLSYSSSPEYTCRASQSIWERF
RLSRRRHKEEEEFMAAGHALRKKVQFAKDEDLHDILDYWKGVSAQHKS
Download sequence
Identical sequences P0C7U0
ENSP00000456548 gi|191252816|ref|NP_001122108.1| ENSP00000456548 ENSP00000457193 NP_001122108.1.87134 NP_001122108.1.92137 XP_006715788.1.92137 XP_006715789.1.92137 XP_006715790.1.92137 XP_011513699.1.92137 XP_011513700.1.92137 XP_011513703.1.92137 XP_016867692.1.92137 ENSP00000456548 ENSP00000457193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]