SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|192447423|ref|NP_001122298.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|192447423|ref|NP_001122298.1|
Domain Number 1 Region: 4-170
Classification Level Classification E-value
Superfamily EF-hand 8.33e-47
Family Calmodulin-like 0.0000000512
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|192447423|ref|NP_001122298.1|
Sequence length 172
Comment neuronal calcium sensor 1 isoform 2 [Homo sapiens]
Sequence
MATITEKEVQQWYKGFIKDCPSGQLDAAGFQKIYKQFFPFGDPTKFATFVFNVFDENKDG
RIEFSEFIQALSVTSRGTLDEKLRWAFKLYDLDNDGYITRNEMLDIVDAIYQMVGNTVEL
PEEENTPEKRVDRIFAMMDKNADGKLTLQEFQEGSKADPSIVQALSLYDGLV
Download sequence
Identical sequences A0A2I2Z863 A0A2I3TXH2
gi|192447423|ref|NP_001122298.1| NP_001122298.1.87134 NP_001122298.1.92137 XP_003822418.1.60992 XP_016817350.1.37143 ENSP00000404103 ENSP00000472360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]