SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|192448443|ref|NP_068758.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|192448443|ref|NP_068758.3|
Domain Number 1 Region: 148-279
Classification Level Classification E-value
Superfamily FKBP-like 1.16e-39
Family FKBP immunophilin/proline isomerase 0.00031
Further Details:      
 
Domain Number 2 Region: 42-156
Classification Level Classification E-value
Superfamily FKBP-like 1.71e-37
Family FKBP immunophilin/proline isomerase 0.00016
Further Details:      
 
Domain Number 3 Region: 260-376
Classification Level Classification E-value
Superfamily FKBP-like 4.32e-36
Family FKBP immunophilin/proline isomerase 0.00033
Further Details:      
 
Domain Number 4 Region: 384-487
Classification Level Classification E-value
Superfamily FKBP-like 6.87e-31
Family FKBP immunophilin/proline isomerase 0.00051
Further Details:      
 
Domain Number 5 Region: 492-568
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000228
Family Calmodulin-like 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|192448443|ref|NP_068758.3|
Sequence length 582
Comment peptidyl-prolyl cis-trans isomerase FKBP10 precursor [Homo sapiens]
Sequence
MFPAGPPSHSLLRLPLLQLLLLVVQAVGRGLGRASPAGGPLEDVVIERYHIPRACPREVQ
MGDFVRYHYNGTFEDGKKFDSSYDRNTLVAIVVGVGRLITGMDRGLMGMCVNERRRLIVP
PHLGYGSIGLAGLIPPDATLYFDVVLLDVWNKEDTVQVSTLLRPPHCPRMVQDGDFVRYH
YNGTLLDGTSFDTSYSKGGTYDTYVGSGWLIKGMDQGLLGMCPGERRKIIIPPFLAYGEK
GYGTVIPPQASLVFHVLLIDVHNPKDAVQLETLELPPGCVRRAGAGDFMRYHYNGSLMDG
TLFDSSYSRNHTYNTYIGQGYIIPGMDQGLQGACMGERRRITIPPHLAYGENGTGDKIPG
SAVLIFNVHVIDFHNPADVVEIRTLSRPSETCNETTKLGDFVRYHYNCSLLDGTQLFTSH
DYGAPQEATLGANKVIEGLDTGLQGMCVGERRQLIVPPHLAHGESGARGVPGSAVLLFEV
ELVSREDGLPTGYLFVWHKDPPANLFEDMDLNKDGEVPPEEFSTFIKAQVSEGKGRLMPG
QDPEKTIGDMFQNQDRNQDGKITVDELKLKSDEDEERVHEEL
Download sequence
Identical sequences A0A024R1W3 Q96AY3
NP_068758.3.87134 NP_068758.3.92137 9606.ENSP00000317232 ENSP00000317232 ENSP00000317232 ENSP00000455335 gi|192448443|ref|NP_068758.3| ENSP00000408232 ENSP00000456130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]