SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|193083136|ref|NP_940908.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|193083136|ref|NP_940908.2|
Domain Number 1 Region: 5-212
Classification Level Classification E-value
Superfamily L domain-like 1.96e-32
Family Ngr ectodomain-like 0.013
Further Details:      
 
Domain Number 2 Region: 208-309
Classification Level Classification E-value
Superfamily Immunoglobulin 2.79e-16
Family I set domains 0.011
Further Details:      
 
Domain Number 3 Region: 442-510
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000105
Family Fibronectin type III 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|193083136|ref|NP_940908.2|
Sequence length 634
Comment leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 3 [Homo sapiens]
Sequence
MDMNELPTNLPVDTVKLRIEKTVIRRISAEAFYYLVELQYLWVTYNSVASIDPSSFYNLK
QLHELRLDGNSLAAFPWASLLDMPLLRTLDLHNNKITSVPNEALRYLKNLAYLDLSSNRL
TTLPPDFLESWTHLVSTPSGVLDLSPSRIILGLQDNPWFCDCHISKMIELSKVVDPAIVL
LDPLMTCSEPERLTGILFQRAELEHCLKPSVMTSATKIMSALGSNVLLRCDATGFPTPQI
TWTRSDSSPVNYTVIQESPEEGVRWSIMSLTGISSKDAGDYKCKAKNLAGMSEAVVTVTV
LGITTTPIPPDTSERTGDHPEWDVQPGSGRSTSVSSASSYLWSSSFSPTSSFSASTLSPP
STASFSLSPFSSSTVSSTTTLSTSISASTTMANKRSFQLHQGGKRNLKVAKNGSKLPPAS
TSKKEELALLDQTMLTETNAAIENLRVVSETKESVTLTWNMINTTHNSAVTVLYSKYGGK
DLLLLNADSSKNQVTIDGLEPGGQYMACVCPKGVPPQKDQCITFSTERVEGDDSQWSLLL
VVTSTACVVILPLICFLLYKVCKLQCKSEPFWEDDLAKETYIQFETLFPRSQSVGELWTR
SHRDDSEKLLLCSRSSVESQVTFKSEGSRPEYYC
Download sequence
Identical sequences 9606.ENSP00000369252 ENSP00000369252 gi|193083136|ref|NP_940908.2| ENSP00000369252 NYSGRC-IgSF-LRIT3_HUMAN

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]