SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|193788651|ref|NP_001123362.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|193788651|ref|NP_001123362.1|
Domain Number 1 Region: 11-245
Classification Level Classification E-value
Superfamily L domain-like 8.39e-41
Family Internalin LRR domain 0.0084
Further Details:      
 
Weak hits

Sequence:  gi|193788651|ref|NP_001123362.1|
Domain Number - Region: 239-276
Classification Level Classification E-value
Superfamily EF2947-like 0.0654
Family EF2947-like 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|193788651|ref|NP_001123362.1|
Sequence length 347
Comment leucine-rich repeat-containing protein 69 [Homo sapiens]
Sequence
MTERLLIKALSGGKNTKIITLNGKKMTKMPSALGKLPGLKTLVLQNNLIPKVCPELCNLT
QLTTLNLGNNLLEEVPEEMKYLTSLKNLHLSGNRICRFAPGACDGLQNLILLNLNNNHLT
QLPQEVSRLKSLTYMSINYNQLASIPRELCFLENLVELQLNYNQLICIPEEIKFLKKLQK
LLLARNNIGVLPEELCDLKKLRILDIAGNIIQIFPSGFQDLKLREFYCEGNPLFLQQPVI
STQQENVWSLQEITSRFVMNQLAENNPFLMDDIERYPQVRSMISQGKTCAICGQYFITVW
LECVRFVPPPKDWKISKNLKLVPLQVLICSYKCFTQRDPNLFGIAQV
Download sequence
Identical sequences Q6ZNQ3
9606.ENSP00000400803 ENSP00000400803 NP_001123362.1.87134 NP_001123362.1.92137 ENSP00000400803 gi|193788651|ref|NP_001123362.1| ENSP00000400803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]