SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|194018546|ref|NP_001034450.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|194018546|ref|NP_001034450.2|
Domain Number 1 Region: 158-407
Classification Level Classification E-value
Superfamily RNI-like 0.0000000000000186
Family Cyclin A/CDK2-associated p19, Skp2 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|194018546|ref|NP_001034450.2|
Sequence length 474
Comment PRAME family member 10 [Homo sapiens]
Sequence
MSLQAPSRLLELAGQSLLRNQFLTIFTLDELPREVFPLMFMEAFSMRRFEALKLMVQAWP
FLSLPLGSLMKTLHLETLQAVLRGLDTLVAQKVRPRRWKLQVLDLRDVDENFWTIWSGAR
VLSCSPEAMSKRQTVEDCPRMGEHQPLKVFIDLCLKESTLDECLSYLFGWIHYRRGLVHL
CCSKVQNYSMPTSSFRNLLERIYPDSIQELEVWKKCSLNKTGKFAPYLSQMSNLRELFLA
FGYERELYVSVQWPCIPDLDSPFLCLYYPQMLYIKKISNIKEHLEHLLRYLKNPLGAFIF
SDAYLTDRDMECLSQYPSLSQLKELRLIHILMWTTHLEPLGVLLEKVAATLKTLVLKDCR
IQDPQLRVLLPALSHCSQLTTFNFHGNETSMNALKDLLRHTGGLSKLGLELYPAPLESLD
YKGHVNWEILTPIRAELMRTLREVRQPKRIFFGPVPCPNCGSWPSEKVDFHLCS
Download sequence
Identical sequences ENSP00000235347 gi|194018546|ref|NP_001034450.2| 9606.ENSP00000235347 ENSP00000235347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]