SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|194097471|ref|NP_001123507.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|194097471|ref|NP_001123507.1|
Domain Number 1 Region: 4-125
Classification Level Classification E-value
Superfamily PH domain-like 3.29e-18
Family Pleckstrin-homology domain (PH domain) 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|194097471|ref|NP_001123507.1|
Sequence length 189
Comment pleckstrin homology domain-containing family B member 1 isoform d [Homo sapiens]
Sequence
MALVRGGWLWRQSSILRRWKRNWFALWLDGTLGYYHDETAQDEEDRVLIHFNVRDIKIGP
ECHDVQPPEGRSRDGLLTVNLREGGRLHLCAETKDDALAWKTALLEANSTPVRVYSPYQD
YYEVVPPNAHEATYVRSYYGPPYAGPGVTHVIVREDPCYSAGAPLAMGMLAGAATGAALG
SLMWSPCWF
Download sequence
Identical sequences A0A024R5H7
GO.35231 ENSP00000227214 ENSP00000442616 ENSP00000227214 ENSP00000442616 NP_001123507.1.87134 NP_001123507.1.92137 NP_001123508.1.87134 NP_001123508.1.92137 XP_011543495.1.92137 gi|194097471|ref|NP_001123507.1| gi|194097473|ref|NP_001123508.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]