SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|194097489|ref|NP_015559.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|194097489|ref|NP_015559.2|
Domain Number 1 Region: 315-445
Classification Level Classification E-value
Superfamily PH domain-like 1.11e-36
Family Ran-binding domain 0.000000635
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|194097489|ref|NP_015559.2|
Sequence length 499
Comment ran-binding protein 3 isoform RANBP3-b [Homo sapiens]
Sequence
MADLANEEKPAIAPPVFVFQKDKGQKRSAGGSSPEGGEDSDREDGNYCPPVKRERTSSLT
QFPPSQSEERSSGFRLKPPTLIHGQAPSAGLPSQKPKEQQRSVLRPAVLQAPQPKALSQT
VPSSGTNGVSLPADCTGAVPAASPDTAAWRSPSEAADEVCALEEKEPQKNESSNASEEEA
CEKKDPATQQAFVFGQNLRDRVKLINESVDEADMENAGHPSADTPTATNYFLQYISSSLE
NSTNSADASSNKFVFGQNMSERVLSPPKLNEVSSDANRENAAAESGSESSSQEATPEKES
LAESAAAYTKATARKCLLEKVEVITGEEAESNVLQMQCKLFVFDKTSQSWVERGRGLLRL
NDMASTDDGTLQSRLVMRTQGSLRLILNTKLWAQMQIDKASEKSIRITAMDTEDQGVKVF
LISASSKDTGQLYAALHHRILALRSRVEQEQEAKMPAPEPGAAPSNEEDDSDDDDVLAPS
GATAAGAGDEGDGQTTGST
Download sequence
Identical sequences gi|194097489|ref|NP_015559.2| NP_015559.2.87134 NP_015559.2.92137 ENSP00000034275 ENSP00000034275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]