SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|194239699|ref|NP_689928.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|194239699|ref|NP_689928.3|
Domain Number 1 Region: 51-290
Classification Level Classification E-value
Superfamily L domain-like 1.93e-25
Family Internalin LRR domain 0.022
Further Details:      
 
Domain Number 2 Region: 337-422
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.95e-16
Family Ubiquitin-related 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|194239699|ref|NP_689928.3|
Sequence length 424
Comment tubulin-specific chaperone cofactor E-like protein [Homo sapiens]
Sequence
MDQPSGRSFMQVLCEKYSPENFPYRRGPGMGVHVPATPQGSPMKDRLNLPSVLVLNSCGI
TCAGDEKEIAAFCAHVSELDLSDNKLEDWHEVSKIVSNVPQLEFLNLSSNPLNLSVLERT
CAGSFSGVRKLVLNNSKASWETVHMILQELPDLEELFLCLNDYETVSCPSICCHSLKLLH
ITDNNLQDWTEIRKLGVMFPSLDTLVLANNHLNAIEEPDDSLARLFPNLRSISLHKSGLQ
SWEDIDKLNSFPKLEEVRLLGIPLLQPYTTEERRKLVIARLPSVSKLNGSVVTDGEREDS
ERFFIRYYVDVPQEEVPFRYHELITKYGKLEPLAEVDLRPQSSAKVEVHFNDQVEEMSIR
LDQTVAELKKQLKTLVQLPTSNMLLYYFDHEAPFGPEEMKYSSRALHSFGIRDGDKIYVE
SKTK
Download sequence
Identical sequences Q5QJ74
ENSP00000284259 9606.ENSP00000284259 ENSP00000403925 ENSP00000437184 NP_001123519.1.87134 NP_001123519.1.92137 NP_689928.3.87134 NP_689928.3.92137 XP_016872815.1.92137 ENSP00000403925 ENSP00000437184 gi|194239699|ref|NP_689928.3| gi|194239701|ref|NP_001123519.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]