SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|194272226|ref|NP_001123563.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|194272226|ref|NP_001123563.1|
Domain Number 1 Region: 50-196
Classification Level Classification E-value
Superfamily L domain-like 4.42e-32
Family U2A'-like 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|194272226|ref|NP_001123563.1|
Sequence length 457
Comment leucine-rich repeat-containing protein 48 isoform b [Homo sapiens]
Sequence
MNQPCNSMEPRVMDDDMLKLAVGDQGPQEEAGQLAKQEGILFKDVLSLQLDFRNILRIDN
LWQFENLRKLQLDNNIIEKIEGLENLAHLVWLDLSFNNIETIEGLDTLVNLEDLSLFNNR
ISKIDSLDALVKLQVLSLGNNRIDNMMNIIYLRRFKCLRTLSLSRNPISEAEDYKMFICA
YLPDLMYLDYRRIDDHTKKLAEAKHQYSIDELKHQENLMQAQLEDEQAQREELEKHKTAF
VEHLNGSFLFDSMYAEDSEGNNLSYLPGVGELLETYKDKFVIICVNIFEYGLKQQEKRKT
ELDTFSECVREAIQENQEQGKRKIAKFEEKHLSSLSAIREELELPNIEKMILECSADISE
LFDALMTLEMQLVEQLEETINMFERNIVDMVGLFIENVQSLMAQCRDLENHHHEKLLEIS
ISTLEKIVEGDLDEDLPNDLRAGRFQKFNYVEASGTF
Download sequence
Identical sequences ENSP00000382136 ENSP00000394020 ENSP00000462661 NP_001123563.1.87134 NP_001123563.1.92137 NP_001123564.1.87134 NP_001123564.1.92137 gi|194272226|ref|NP_001123563.1| gi|194272228|ref|NP_001123564.1| ENSP00000382136 ENSP00000462661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]