SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|194294552|ref|NP_001038944.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|194294552|ref|NP_001038944.2|
Domain Number 1 Region: 16-108
Classification Level Classification E-value
Superfamily EF-hand 2.02e-20
Family S100 proteins 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|194294552|ref|NP_001038944.2|
Sequence length 112
Comment protein S100-A7-like 2 [Homo sapiens]
Sequence
MLPSSGFLKAKMNIPLGEKVMLDIVAMFRQYSGDDGRMDMPGLVNLMKENFPNFLSGCEK
SDMDYLSNALEKKDDNKDKKVNYSEFLSLLGDITIDHHKIMHGVAPCSGGSQ
Download sequence
Identical sequences 9606.ENSP00000405610 ENSP00000357714 NP_001038944.2.87134 NP_001038944.2.92137 ENSP00000357714 ENSP00000357714 gi|194294552|ref|NP_001038944.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]