SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|194328809|ref|NP_001123616.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|194328809|ref|NP_001123616.1|
Domain Number 1 Region: 911-980
Classification Level Classification E-value
Superfamily TB module/8-cys domain 7.98e-21
Family TB module/8-cys domain 0.0000687
Further Details:      
 
Domain Number 2 Region: 400-462
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.01e-17
Family TB module/8-cys domain 0.00047
Further Details:      
 
Domain Number 3 Region: 789-910
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.18e-17
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 4 Region: 669-789
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000989
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 5 Region: 971-1123
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000816
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 6 Region: 1132-1186
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000000116
Family TB module/8-cys domain 0.0019
Further Details:      
 
Domain Number 7 Region: 575-703
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000439
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 8 Region: 273-350
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000000471
Family TB module/8-cys domain 0.003
Further Details:      
 
Domain Number 9 Region: 348-395
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000306
Family EGF-type module 0.0031
Further Details:      
 
Domain Number 10 Region: 1221-1262
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000579
Family EGF-type module 0.007
Further Details:      
 
Domain Number 11 Region: 1248-1298
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000114
Family EGF-type module 0.01
Further Details:      
 
Domain Number 12 Region: 113-142
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000305
Family EGF-type module 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|194328809|ref|NP_001123616.1|
Sequence length 1303
Comment latent-transforming growth factor beta-binding protein 3 isoform 1 precursor [Homo sapiens]
Sequence
MPGPRGAAGGLAPEMRGAGAAGLLALLLLLLLLLLGLGGRVEGGPAGERGAGGGGALARE
RFKVVFAPVICKRTCLKGQCRDSCQQGSNMTLIGENGHSTDTLTGSGFRVVVCPLPCMNG
GQCSSRNQCLCPPDFTGRFCQVPAGGAGGGTGGSGPGLSRTGALSTGALPPLAPEGDSVA
SKHAIYAVQVIADPPGPGEGPPAQHAAFLVPLGPGQISAEVQAPPPVVNVRVHHPPEASV
QVHRIESSNAESAAPSQHLLPHPKPSHPRPPTQKPLGRCFQDTLPKQPCGSNPLPGLTKQ
EDCCGSIGTAWGQSKCHKCPQLQYTGVQKPGPVRGEVGADCPQGYKRLNSTHCQDINECA
MPGVCRHGDCLNNPGSYRCVCPPGHSLGPSRTQCIADKPEEKSLCFRLVSPEHQCQHPLT
TRLTRQLCCCSVGKAWGARCQRCPTDGTAAFKEICPAGKGYHILTSHQTLTIQGESDFSL
FLHPDGPPKPQQLPESPSQAPPPEDTEEERGVTTDSPVSEERSVQQSHPTATTTPARPYP
ELISRPSPPTMRWFLPDLPPSRSAVEIAPTQVTETDECRLNQNICGHGECVPGPPDYSCH
CNPGYRSHPQHRYCVDVNECEAEPCGPGRGICMNTGGSYNCHCNRGYRLHVGAGGRSCVD
LNECAKPHLCGDGGFCINFPGHYKCNCYPGYRLKASRPPVCEDIDECRDPSSCPDGKCEN
KPGSFKCIACQPGYRSQGGGACRDVNECAEGSPCSPGWCENLPGSFRCTCAQGYAPAPDG
RSCLDVDECEAGDVCDNGICSNTPGSFQCQCLSGYHLSRDRSHCEDIDECDFPAACIGGD
CINTNGSYRCLCPQGHRLVGGRKCQDIDECSQDPSLCLPHGACKNLQGSYVCVCDEGFTP
TQDQHGCEEVEQPHHKKECYLNFDDTVFCDSVLATNVTQQECCCSLGAGWGDHCEIYPCP
VYSSAEFHSLCPDGKGYTQDNNIVNYGIPAHRDIDECMLFGSEICKEGKCVNTQPGYECY
CKQGFYYDGNLLECVDVDECLDESNCRNGVCENTRGGYRCACTPPAEYSPAQRQCLSPEE
MDVDECQDPAACRPGRCVNLPGSYRCECRPPWVPGPSGRDCQLPESPAERAPERRDVCWS
QRGEDGMCAGPLAGPALTFDDCCCRQGRGWGAQCRPCPPRGAGSHCPTSQSESNSFWDTS
PLLLGKPPRDEDSSEEDSDECRCVSGRCVPRPGGAVCECPGGFQLDASRARCVDIDECRE
LNQRGLLCKSERCVNTSGSFRCVCKAGFARSRPHGACVPQRRR
Download sequence
Identical sequences Q9NS15
NP_001123616.1.87134 NP_001123616.1.92137 ENSP00000326647 gi|194328809|ref|NP_001123616.1| ENSP00000301873 ENSP00000301873 9606.ENSP00000301873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]